KEGG   Frankia sp. CcI3: Francci3_1329Help
Entry
Francci3_1329     CDS       T00320                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
fra  Frankia sp. CcI3
Pathway
fra00071  Fatty acid degradation
fra00280  Valine, leucine and isoleucine degradation
fra00281  Geraniol degradation
fra00310  Lysine degradation
fra00362  Benzoate degradation
fra00380  Tryptophan metabolism
fra00410  beta-Alanine metabolism
fra00640  Propanoate metabolism
fra00650  Butanoate metabolism
fra00903  Limonene and pinene degradation
fra00930  Caprolactam degradation
fra01040  Biosynthesis of unsaturated fatty acids
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
fra01212  Fatty acid metabolism
Module
fra_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Francci3_1329
   00650 Butanoate metabolism
    Francci3_1329
  Lipid metabolism
   00071 Fatty acid degradation
    Francci3_1329
   01040 Biosynthesis of unsaturated fatty acids
    Francci3_1329
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Francci3_1329
   00310 Lysine degradation
    Francci3_1329
   00380 Tryptophan metabolism
    Francci3_1329
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Francci3_1329
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Francci3_1329
   00281 Geraniol degradation
    Francci3_1329
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Francci3_1329
   00930 Caprolactam degradation
    Francci3_1329
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Francci3_1329
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Francci3_1329
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Francci3_1329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABD10706
JGI: Francci31329
RhizoBase: Francci3_1329
UniProt: Q2JDD6
Position
complement(1593921..1596068)
Genome map
AA seq 715 aa AA seqDB search
MTIDEVTLSFPGEVVTAAHVRYARLPEVAGPVALITLDNGHDHTRPNTFGPAGLRSLLAA
VDEIEAHDPPVAAIAVTGKPFIFSVGADLSFRSSLTDPERIRPSLAALGRLGHEAFARVG
EGRLGDRKVPTFALVNGAALGGGLELALHCDYRALSAGIPALAFPEVFLGLVPGWGGTQL
LPNLIGAERAVSVVIGNALSQNRMLRGRQAFELGLGDVLLEPADFLAEALRWVGQVLRGD
VDPVAARAPVERGAGWAEAIARGRTLADAKLHGAAPAAYRALDLLALAETADRATGYAAE
TEALADLSVSDELAASLYSFDLVQKRAKRPVGGPDPALARPVTKVGVVGAGLMASQLALV
FAHRLEVPVVLTDIDQARLDAGVAGVHQEVDNLLLRHRITPDQANRYKANVTGSLTKDAF
ADADLVIEAVFENLAVKRTVLAELEAVVAPTAVLLTNTSALSVTEMAAGLDHPERVAGLH
FFNPVSVLPLVEVVRAARSDDATIATTLAVAKNLKKNAVLVADAPAFVVNRLLTRFLGEV
LGATEGGTPLEEADHALDPLGLPMSPMTLLALVGPPVALHVAETLHAAFPDRFRRPTALA
RLVEAGRSGVYTTGPDGVQTVDPDAAALIFTPSPAATPLTGDEVREAALRALAEEIHLML
TEKIVAEAADIDLCMILGAGWPFHLGGITPYLDRSGISEAVTGQRFAPPGVATLR
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacgaggtgaccctgtccttcccgggcgaggtcgtcacggccgcccacgtc
cgctacgcgcggctgcccgaggtggccgggcccgtcgccctgatcaccctcgacaacggt
catgaccacacccggccgaacaccttcggcccggccggcctgcggtccctgctcgccgcc
gtcgacgagatcgaggcgcacgacccgccggtcgccgcgatcgccgtcaccggcaagccg
ttcatcttcagcgtgggtgcggacctgtccttccgctcatcgctcaccgacccggagcgg
atccgcccctcgctcgcggcgctcggccgcctcgggcacgaggccttcgcccgggtgggt
gagggtcgcctgggtgaccggaaggtcccgaccttcgccctcgtcaacggggcggcgctg
ggcggcgggctggagctggccctgcactgcgactaccgggcgctgtccgccggcattccc
gcactcgccttcccagaggtcttcctcggcctcgtcccgggctggggcggcacccagctg
ctgcccaacctcatcggcgccgaacgggcggtgtccgtcgtcatcggcaacgcgctcagc
cagaaccgcatgctgcgcggccggcaggcgttcgagctgggtctcggggacgtgctgctg
gagccggcggacttcctggcggaggcgctgcgctgggtgggccaggtgctgcgcggcgat
gtcgacccggtggccgcccgcgcgccggtcgagcggggggcgggctgggcggaggcgatc
gcacggggccggacgctcgccgacgcgaagctgcacggggccgcgccggccgcctaccgg
gcgttggacctcctcgcgctcgccgagaccgccgaccgcgccaccgggtacgcggccgag
accgaggccctcgccgatctgtccgtcagcgacgaactcgccgccagcctgtactccttc
gacctcgtgcagaagcgggcgaagcggccggtgggcgggccggacccggcgctggcccgg
cccgtgacgaaggtcggggtggtcggcgccggcctcatggcaagccagctcgccctcgtg
ttcgcgcaccggctcgaggtgccggtggtgctcaccgacatcgaccaggcccggctcgac
gccggggtcgcgggggtccaccaggaggtcgacaacctcctgctgcgccaccgcatcacc
cccgaccaggcgaaccgctacaaggcgaacgtcaccggatccctgaccaaggacgccttc
gcggacgcggacctcgtcatcgaggccgtcttcgagaacctggccgtcaagcggaccgtg
ctcgcggagctcgaggccgtcgtggcgcccacggccgtgctcctgacgaacacctcggcg
ctgtcggtcaccgagatggccgctgggctcgatcatcccgaacgggtagccgggctgcac
ttcttcaatccggtgtcggtcctccccctggtcgaggtggtccgcgctgcccgcagcgac
gacgccaccatcgcgacgacgctggccgtggcgaagaacctgaagaagaacgcggtcctg
gtcgccgatgccccggcgttcgtcgtcaaccggctgctgacgcggttcctcggggaggtg
ctcggcgcgacagagggcggtacgccgctcgaggaggccgaccacgccctcgatccgctg
gggctgccgatgtccccgatgaccctgctcgccctcgtcgggccgccggtcgccctgcac
gtcgcggagacactgcacgcggcgttcccggaccggttccggcggccgacggctctcgcc
cggctggtcgaggcgggccggagcggcgtctacaccacgggcccggacggcgtccagacc
gtcgacccggacgccgccgcgctcatcttcacgccgtccccggccgccaccccgctgacc
ggggacgaggtacgcgaggcggcgctgcgggcgctcgccgaggagatccatctgatgctg
accgagaagatcgtcgcggaggccgccgacatcgacctgtgcatgatcctcggcgccggc
tggccgttccacctcggcggcatcacgccctacctggaccgtagcggcatcagcgaggcc
gtcaccgggcagcgcttcgccccgccgggggtcgccaccctgcgctga

DBGET integrated database retrieval system