KEGG   Frankia sp. CcI3: Francci3_1335Help
Entry
Francci3_1335     CDS       T00320                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
fra  Frankia sp. CcI3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_1335
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Francci3_1335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1602461..1603876
Genome map
AA seq 471 aa AA seqDB search
MRVVIVGGGIAGLSAARALAGHAEVTVLDAADRVGGKLRTTPIEGLDVEEGAESFLARVP
DGLRLARQIGLGHEIVHPATTSASLWIRGRLHPIPPNTLLGVPTDVLGLLRSRVLSPWGL
VRAAADLVLPRTRFADDPTVGRYVGTRVGREVVDLLVDPLLGGVYAGRADALSLRATVPQ
LVPIFAEDRSLLLGAHRVRARTGPATTTSTAPLFATLRGGLGSFAARVAAQSGATVRTGV
LVRSIAKTAGGWQVNCDRVGGADALGPFQADAVILAVPAGVARALLAPLAPHASAPLAGV
PYASVGLVTLVYRDAAPPPGSGFLVPARAGTAVKAATFLSAKWPHLGSDRLTVVRASIGR
AGAEQDLQRGDVELAGVAAAEIAQITGLSGRPVATRVSRWGGALPQYLPGHLNRIAAVRR
GLPAGIALAGAGYDGVGIPACIRSGETAAHAVLRATRTAQGSPADPVGPGI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggttgtgatcgtcggtgggggtatcgccgggctctcggccgcccgcgccttggcc
gggcacgccgaagtgaccgtcctcgatgcggcggaccgggtcggtggcaagctgcgtacc
accccgatcgagggtctggacgtcgaagagggcgcggagtccttcctcgcccgggttccc
gacggactccgcctggcccggcagatcgggctcgggcacgagatcgtgcatccggccacg
acgtcagcctcactgtggatccgcggccggctgcatcccatccccccgaacaccctgctc
ggagtgccgaccgacgtcctcggcctgctccgctcgcgggtgctgtccccgtgggggctg
gtgcgggccgccgccgacctggtgctgccgcggacgcgtttcgccgacgatccgaccgtc
ggtcgctacgtcggcacgcgggtcgggcgcgaagtcgtcgacctgctggtggatccgctg
ctcgggggggtgtatgcgggccgggccgacgcgctgtcgctgcgggcgaccgtgccccag
ctcgtccccatcttcgccgaggaccgctcgctgctcctcggcgcgcaccgggtgcgggcc
cgtaccggacccgcgacgacgacctcgacggcgccgctgttcgccacgcttcgggggggg
ctgggctccttcgcggcgcgagtggcggcgcagtccggcgccaccgtgcgcaccggggtg
ctcgtccgctcgatcgcgaagaccgcgggcggctggcaggtcaactgtgaccgggtgggc
ggcgcggacgccctcgggccgttccaggccgacgccgtgatcctcgcggtgcctgccggg
gtggcccgcgccctgctggcgccgctggccccgcatgcctccgccccgcttgccggcgtg
ccctacgcctcggtcggcctggtgacgctggtctaccgggacgccgcgccgccacccggc
agcggattcctcgtgcccgcccgggcgggcaccgcggtgaaggcggccaccttcctgtcc
gccaagtggccgcacctgggctccgaccggctcacggtggtgcgggcgagcatcggccgc
gccggtgccgaacaggacctgcagcgcggggatgtggagctcgccggggtggcggcggcg
gagatcgcgcagatcaccggcctgtccggtcggccggtagcgacccgggtgagtcgctgg
ggcggggcgctcccgcagtacctgccgggtcatctcaaccggatcgccgcggtgcgccgg
gggcttccagcggggatcgccctcgccggcgcgggatacgacggtgtaggcatcccggcc
tgcatccggtcgggggagaccgccgcgcacgcggtgctgagggctacccggacggcgcag
ggcagtccggccgatccggtgggcccgggaatctga

DBGET integrated database retrieval system