KEGG   Frankia sp. CcI3: Francci3_1340Help
Entry
Francci3_1340     CDS       T00320                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fra  Frankia sp. CcI3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:fra00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1609147..1609959
Genome map
AA seq 270 aa AA seqDB search
MNTDDTRPPSTVPVDIATDELDDDVLARRLATDAGKLLLRIREEVGFAEPATLRDAGDAR
SHQLLTRALARHRPRDAVLSEEGVDDVARLSAERVWIVDPLDGTREFAEPGRSDWAVHVA
LWQAGELVSGAVALPALGLTLSSAGGLPPRLAGARPPRIVVSRTRAPQLVTEVAEALGAT
IVPMGSAGAKAGAVIRGEAEIYLHAGGQYEWDSAAPVAVARSAGLHTSRLDGSPLRYNQP
DPLLPDLVICAASWASEVLRAIGAAGGSGG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatgacacccgcccgccgtccaccgtgccggtcgacatcgcgaccgacgaa
ctcgatgacgacgtcctggcccgacggttggccacggacgccggcaaactgctgttgcgg
atcagggaggaggtcgggttcgccgaacccgcgaccctgcgtgacgccggggacgcgcgt
tcgcatcagctcctgacccgggcgttggcgcggcaccgcccgcgggacgctgtgctgtcc
gaggagggcgttgacgacgtcgcgcggctgtccgcggagcgggtctggatcgtcgacccc
ctggacggcacccgcgagttcgccgaacccggcaggtcggactgggcggtgcatgtcgcg
ctctggcaggccggcgagctcgtctcgggcgcggtggcgctgccggcgctcgggttgacg
ctgtccagcgcgggcgggctgccgccgcggctggccggggcgcgtccgccacggatcgtg
gtcagccggacccgggccccacagctggtcacggaggtcgcggaggcactgggcgccacc
atcgtcccgatgggttcggccggtgcgaaggccggcgccgtcatccgcggggaagccgag
atctacctgcacgccggcggccagtacgagtgggactccgccgccccggtggcggtcgcg
cggtcggcggggctgcacaccagccggctggacggctcgccgctgcggtacaaccagccc
gacccgctgttgcccgacctggtcatctgtgctgcgagctgggcatcggaggttctccgg
gcgatcggcgccgcggggggctccggcggttga

DBGET integrated database retrieval system