KEGG   Frankia sp. CcI3: Francci3_1355Help
Entry
Francci3_1355     CDS       T00320                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
fra  Frankia sp. CcI3
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Francci3_1355
Enzymes [BR:fra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Francci3_1355
    3.5.1.-  
     Francci3_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(1627983..1628570)
Genome map
AA seq 195 aa AA seqDB search
MSQRYGPGTALLIVDVQNDFTDPAGSLYVAGGEQIIAGINAEIAAAVAAGSPVFYSQDWH
PHETPHFVTGGGIWPPHCVGDTPGAQFHPDLIVKGEVIRKGVDGSDGYSAFSVRDPASGR
RAATVLGERLAQLGVSRVVVVGLAGDYCVQESALDARLRGLKVLLPLDLTRFVNLRPGDD
ERAVARLRDAGVLVG
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcgttacgggccggggaccgccctgctgatcgtggacgtgcagaacgacttc
accgatccggccggcagcctctacgtggccggcggtgagcagatcatcgccgggatcaat
gcggagatcgccgcggcggtggccgccggctccccggtcttctacagccaggactggcac
ccgcacgagaccccgcacttcgtcaccggcggcgggatctggccgccgcactgcgtcggg
gacacccccggcgcccagttccatcccgacctgatcgtcaagggtgaggtgatccgcaag
ggggtcgacggcagcgacggctactcggccttctcggtgcgtgacccggcatcggggcgg
cgggccgccacggtgctcggtgaacggctggcacagctgggcgtgtcgagggtggtggtc
gtcgggctggccggcgactactgcgtccaggagagcgcgctggacgcccggctgcggggc
ctgaaggtgctgctgccactcgacctcaccaggttcgtcaacctgcgcccgggcgacgac
gagcgagccgtggcacgcctgcgggacgccggcgttctggtcgggtga

DBGET integrated database retrieval system