KEGG   Frankia sp. CcI3: Francci3_1370Help
Entry
Francci3_1370     CDS       T00320                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fra  Frankia sp. CcI3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Francci3_1370
Enzymes [BR:fra01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Francci3_1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1644456..1645199
Genome map
AA seq 247 aa AA seqDB search
MIASLAGTVTALTPLSAVIEVGGVGLLVHCSPSTLSRLRVGESASLATTLIVRETELTLY
GFADADARDVFEILQSAAGVGPKLAQAVLGVHDPDTVRRAVAEEDLAVLTKVPGIGRKGA
QRIVLDLRDRLGPPGDGAPLPGPRLTSGPEPMPADAVGVAATVREALVGLGYSGREADAA
VSRALVVLAAPVGEGAAAGGEQAAPGKGDVPGKEGAPGSRAGADSGTGGAPPDTATLLRA
SLAVLRR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgtcgttggccggcacggtcaccgcgctgaccccgctgtccgccgtcatcgag
gtcggcggggtgggcctgctcgtccactgctcgccgtcgacgctgtcgcggctgcgggtg
ggggagtccgcctccctcgccaccaccctgatcgtgcgcgagaccgagctgaccctctac
ggcttcgccgacgccgatgcgcgcgacgtcttcgagatcctgcagagcgcggccggggtc
gggcccaagctcgcccaggccgtgctcggggtgcacgatcccgacacggtgcgccgcgcc
gtcgccgaggaggatctcgcggtgctgacgaaggtccccggtatcgggcgcaagggcgcg
cagcgcatcgtcctggacctgcgggaccggctcggtccgccgggtgacggtgcgccgctg
cccggcccgcgcctgacgtcgggaccggaaccgatgccggccgatgccgtcggggtcgcg
gcgaccgtgcgggaggcgctggtgggcctgggctactcgggtcgtgaggccgacgccgcc
gtgtcccgggcgctcgtggtcctggccgcgcccgtcggcgagggcgccgcagccggtggc
gagcaggccgccccgggcaagggagacgtcccgggaaaggaaggcgccccgggttcccgg
gccggggccgactcgggaaccggcggcgctccgcccgacaccgcgaccctgctgcgcgcg
agtcttgccgtgctacgcaggtga

DBGET integrated database retrieval system