KEGG   Frankia sp. CcI3: Francci3_1410Help
Entry
Francci3_1410     CDS       T00320                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fra  Frankia sp. CcI3
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Francci3_1410
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Francci3_1410
Enzymes [BR:fra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Francci3_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1698223..1699857
Genome map
AA seq 544 aa AA seqDB search
MAVPAPTKVVTVTSPAPRPAAPPACSLADLRAVLAAVAPVPEPAAFAGAGHSPSDTHADT
HADTDTDVIVHGVTHDSHAVRPGDLHAALPGAHTHGAAFAAAAVAGGAVAVLTDAEGARR
IAAMPPGPPGEVPVLVSDDPRRDLAPVAARIYGDPSAALRLLGVTGTNGKTTTAFLLDAG
LRAAGHTTGLIGTIETRIADERLASARTTPEASDLQALLATMVERGVGAATMEVSSHALA
LHRADALHFAGAVFTNLSQDHLDFHSSMEDYFAAKASLFDPARTAVAVIGVADRWGRRLA
ERHPGAITFAVEGPADWTARDVSYGPTGTLLRAEGPDGLRVDLSVPLPGAFNVANTLGAL
ALLVAIGVPPATAAAGIGSLPGVPGRMERVDAGQPFLALVDFAHTPDAVTTLLETVRPLV
KGRVIVVLGCGGDRDRGKRPLMGAAAATLADVAILTNDNPRSEDPAEILAQMLAGVTALS
ASATVLVEPDRAAAIAAAVAEAGPQDAVVVAGKGHESGQEQAGVVTPFDDRVALRAALSS
VERR
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcccgcccccactaaggtcgtgaccgtgacctctccggcacctcgaccggct
gccccgcccgcgtgcagcctcgccgatctgcgcgcggtgctcgcggccgtggcgcccgtc
ccggagccggcggcgttcgcgggtgcgggacattcgccgtcggacacacatgcggacaca
catgcggacacggacacggacgtgatcgtgcatggcgtcacccacgactcgcatgcggtc
cggccgggcgacctccacgcggcactgcccggtgcccacacgcacggtgcggccttcgcg
gccgccgcggtggccggcggcgccgtcgccgtgctcaccgacgccgagggcgcccgccgg
atcgcggccatgccgcccggcccccccggggaagtcccggtgcttgtcagcgacgatcca
cggcgcgacctcgccccggtggcggcgaggatctacggtgatccctctgcggcgctgcgc
ctgctcggcgtcaccggcaccaacgggaagacgaccacggccttcctgctcgacgccggg
ctgcgcgccgccggccacaccacgggcctgatcggcacgatcgagacccggatcgccgac
gaacggctggcctccgcccgcaccaccccggaggcgagcgacctgcaggccctgctcgcc
acgatggtcgagcgtggcgtgggggccgccacgatggaggtgtccagccacgcgctggcc
ctgcaccgggccgacgccctgcacttcgccggggccgtgttcaccaacctcagccaggac
catctggacttccactcctccatggaggactacttcgcggcgaaggcgtccctgttcgac
ccggcccggaccgccgtcgcggtgatcggcgtggcggaccggtggggccgccggctcgcc
gaacggcatcccggcgcgatcacgttcgccgtcgaggggccggccgactggacggcccgg
gacgtctcctacgggccgaccggcacactgctgcgcgccgagggtccggacgggctgcgg
gtggatctgtccgtgccgctgcccggcgcctttaacgtcgccaacacgctcggcgcgctg
gcgctgctcgtcgccatcggggtccccccggccacggcggcggcggggatcggctccctg
cccggggtgcccggccggatggagcgggtcgacgccggccagccgttcctggccctggtc
gacttcgcgcacaccccggacgcggtcacgacgctgctcgagacggttcgcccgctggtg
aagggcagggtcatcgtcgtgctcggctgcggtggcgaccgcgaccgcggcaagcgcccg
ctgatgggggccgccgcggcgacactcgccgacgtcgcgatcctcacgaacgacaatccg
cgctcggaggatccggcggagatcctcgcccagatgctcgccggggtcacggcgctgtcg
gcctcggccacggtcttggtcgaaccggaccgcgccgcggccatcgcggccgccgtggcc
gaggccggacctcaggacgccgtcgttgtcgccggcaagggtcatgagtcgggccaggaa
caggcgggggtggtgacccccttcgacgatcgggtcgccctgcgcgccgcgctctcctcg
gtggagaggagatga

DBGET integrated database retrieval system