KEGG   Frankia sp. CcI3: Francci3_1533Help
Entry
Francci3_1533     CDS       T00320                                 

Definition
phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
fra  Frankia sp. CcI3
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Francci3_1533
Enzymes [BR:fra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Francci3_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(1838291..1838929)
Genome map
AA seq 212 aa AA seqDB search
MASVVRTVARTTRHPVVVDMESGYGGPRKVDLAARTISQAGASAVCIEDNTLDKWSILYP
GERDLASVEEQEKCLRATRRGLEPSCFLIARTEALVAGHGVAEALNRANRYVDAGADAVF
VQATRPDGGEELLEFGRGWDRRTPVFIAPTCYPALGAEEYARSGITHWIFANQPLRSVGR
WKTPPNRSEKLGPAPLHNWTIRSHRCQRSETS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgtggtacggaccgtggcgaggacgacgcgtcatccggtggttgtggacatg
gaatccgggtacggaggcccgcgcaaggtagacctggcggcgcggacaatctcccaggcc
ggcgcgagcgcggtgtgcatcgaggacaacacgctggacaagtggtcgatcctgtacccc
ggtgagcgggacctggccagcgtggaagaacaggagaaatgcctccgcgccacgcgccgc
gggctggagcccagctgtttcttgatcgcccgaaccgaagcgttggtggccgggcacggc
gtggccgaggccttgaaccgcgcgaaccgctatgtggatgccggcgcggacgcggtgttt
gtgcaagccacgcgacccgacgggggcgaggaacttctggaattcggccggggatgggat
cggcgcacgccggtgttcatcgcaccaacctgctatccagcgctcggtgccgaggagtac
gccaggtccggtatcacacactggatcttcgcgaaccagcccctccgatctgttgggcga
tggaagacaccgcccaacagatcggagaagctaggaccggccccgctccacaactggacg
atcagatcgcatcggtgtcagagatcggagacctcgtga

DBGET integrated database retrieval system