KEGG   Frankia sp. CcI3: Francci3_1552Help
Entry
Francci3_1552     CDS       T00320                                 

Definition
helicase RecD/TraA (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fra  Frankia sp. CcI3
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fra03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1860507..1862726
Genome map
AA seq 739 aa AA seqDB search
MIGREPFRGAVLDAVLERITYANEETGYTVARVDTGRGGDLVTVVGALLGAQPGESLRMR
GRWGSHPQYGRQFQVEDYTTVLPATVQGVQRYLGSGLIKGIGPRLAERIVEHFGVAALDV
IEKEPERLIEVPKLGPKRTRAIAEAWEEQKAIKEVMVFLQGVGVSTSLAVRIYKQYGDAS
IGVVRNEPYRLATDVWGIGFRTADTIAKAVGIPHDSPQRIKAGLLFTLSEATDGGGHCFL
PEPRLISDAVQILQVDTGDVIECLGELVAEDGVVREEVPSEDPATPTAAIYLVPFHRAEI
SVAGQLRRLLNTGADRLAAFASVDWDRALGWLRERTGVELAPAQRDAVQLALTSRVAVLT
GGPGCGKSFTVRSIVTLALARQAKVILAAPTGRAAKRLTELTGHEASTVHRLLELRPGGD
AAFDRDRPLDADLIVVDEASMVDLLLANKLAKAVPPGAHLLLVGDVDQLPSVGAGQVLRD
LLAEGTPIPHVRLTQVFRAATESGVVTNAHRINRGDYPLVRGLPDFFLFAAEEAEEAAKI
TAEVVARRIPAKFGLDPRRDVQVLTPMHRGPAGAGALNTLLQEALTPSRPNVAERRFGSR
TFRVGDKVTQVRNNYDKGASGVFNGTLGVVTALDVENQTLTIRTDEDEDIDYDFGELDEL
THAYAVTIHRSQGSEYPAVVIPLTTSAWMMLQRNLLYTAVTRAKKLVVLVGSRRAIGQAV
RAAGHGQRHTALDHRLRSG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcgaacccttccgcggcgcggtcctcgatgcggtgctggaacggatcacc
tatgccaacgaggagaccggctacacggtcgcgcgggttgacaccgggcgcggcggtgac
ctggtgaccgtcgtcggggcgttgctcggcgcgcagccgggggagtcgctacggatgcgg
gggcgatggggttcgcacccgcagtacggccgccagttccaggtcgaggattacacgacc
gtgctgccggcgaccgtccagggcgtgcagcgctatctcggctcgggccttatcaagggc
atcggtccgcgcctggccgaacgcatcgtcgagcatttcggggtcgcggcgctggacgtc
atcgaaaaggagccggaacgactcatcgaggtgccgaagctcggcccgaagcgtaccagg
gcgatcgccgaggcgtgggaggaacagaaggccatcaaggaggtgatggtctttcttcag
ggggtgggtgtgtccacctcgctggcggtgcggatctacaaacagtacggggacgcgtcg
atcggtgtggtgcgcaatgagccctaccggctggccacggacgtctggggcatcgggttc
cgcaccgcggacaccatcgcgaaggcggtggggattccgcatgacagtccgcagcggatc
aaggctggcctgctgttcacgctgtccgaggccaccgacggcggtggccactgctttctg
cccgagccccggctcatcagcgacgccgtgcagattctccaggtcgacaccggtgacgtc
atcgagtgcctgggggagctggtcgccgaggacggggtcgtccgggaggaggttccaagc
gaggatccggcgacgccgacggccgcgatctacctggtgccgttccaccgggccgagata
tccgttgccggccagttgcgccgcctgctgaataccggcgcggaccggttggccgccttc
gcctcggtggactgggaccgggcgttgggctggctgcgggagcggaccggggtcgagctc
gcgccggcccagcgcgatgcggtgcagcttgccctgacgtccagggtcgccgtgctgacg
ggcggaccgggctgcggcaagagtttcaccgtccgctccatcgtgacgctcgcactggcc
cggcaggcgaaggtgatcctcgccgcgccgaccggccgggccgcgaagcggctgaccgag
ctgaccgggcacgaggcatcgacggtgcaccggctgctggagctgcggccgggcggtgac
gccgccttcgaccgggaccgcccgctcgacgccgacctgatcgtcgttgacgaggcgtcg
atggtcgacctgctactggcgaacaagcttgccaaggcggttccgcccggcgcgcatctg
ctgctggtcggcgacgtcgaccagctgccgtcggtcggtgccggccaggtgctacgcgac
ctgctcgccgaggggacgccgatcccgcatgtccggctcacccaggtcttccgagcggcg
accgagtccggggtggtgaccaacgcgcaccgcatcaaccgtggtgactatccgctggtc
cggggactgcccgacttcttcttgttcgccgccgaggaggcggaggaggcggcgaaaatc
accgcggaggtggtcgcccggcggattccggcgaagttcgggcttgatccgcgccgggac
gtgcaggtactgaccccgatgcaccgcggcccggcgggggccggcgcgctgaacaccctg
ctgcaggaggccctgacgccgtcccgcccgaacgtggccgagcggcgctttggcagccgg
acgttccgggtcggcgacaaggttacgcaggtgcgcaacaactacgacaagggcgcgagc
ggggtcttcaacggcactctcggcgtggtcaccgcgctggatgtggagaaccagacgctc
accatccggaccgacgaggacgaggacatcgactacgacttcggggagctcgacgagctg
acccacgcctacgcggtgacgatccaccgctcccagggcagtgagtaccccgcggtcgtc
atcccgctcaccaccagcgcctggatgatgctgcaacgcaatctgctctacacggccgtc
acccgggcgaagaagctggtcgtgctggtgggatcccgccgggcgatcggccaggcggtg
cgggccgccggtcacggccagcggcacaccgcgctcgaccaccggctgcgtagcgggtga

DBGET integrated database retrieval system