KEGG   Frankia sp. CcI3: Francci3_1639Help
Entry
Francci3_1639     CDS       T00320                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_1639 (tpiA)
   01230 Biosynthesis of amino acids
    Francci3_1639 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_1639 (tpiA)
   00051 Fructose and mannose metabolism
    Francci3_1639 (tpiA)
   00562 Inositol phosphate metabolism
    Francci3_1639 (tpiA)
Enzymes [BR:fra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Francci3_1639 (tpiA)
Exosome [BR:fra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Francci3_1639 (tpiA)
  Exosomal proteins of bladder cancer cells
   Francci3_1639 (tpiA)
  Exosomal proteins of melanoma cells
   Francci3_1639 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
1971853..1972779
Genome map
AA seq 308 aa AA seqDB search
MALLGRGRSERGSDRGSGKNRGSGKDEDGVGKDRSVKGAAGSKGAAGVKGTGRRTLVAGN
WKMNLNHLEAIALVQKIAFDLKPAELETVEVVVLPPFTDLRSVQTLVDGDKLAIAYGGQD
LSPYASGAHTGDISGAMLAKLGCDYVVVGHSERRADHHEDDALVAAKAKAAFSVGLTPIL
CVGEPEEIRAAGTQVEHVLRQLERSLAGITAEQAATIVIAYEPVWAIGTGRTASAQDAQD
MCAAVRGQLASQYGDEIAAGIRVLYGGSVKAANAGELFTMPDVDGGLVGGASLVAEEFVG
IVRSGPPA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctgggccggggaagatctgagcgaggttccgacaggggatccgggaagaac
aggggatccgggaaggacgaggacggcgtgggcaaggacaggtcggtgaagggcgctgcc
ggttcaaagggcgccgccggcgtcaagggcaccggccgacggacgctggtagccggcaac
tggaagatgaacctcaatcacctcgaggcgatcgcgctggtgcagaagatcgccttcgat
ctcaagcccgccgagctggagaccgtcgaggtcgtcgttctcccgccgttcaccgatctg
cgcagcgtgcagaccctggtggacggggacaagctcgccatcgcctacggcgggcaggac
ctctccccctacgcgtcgggtgcgcacaccggtgacatcagcggggcgatgctggccaag
ctcggctgcgactacgtcgtcgtcgggcactccgagcgccgggccgaccaccacgaggac
gacgcgctggtggcggccaaggcgaaggcggccttctccgtggggctcacccctatcctg
tgcgtgggggagcccgaggagatccgggccgccggcacccaggtcgagcacgtgctgcgt
cagctcgagcggtcgctggctggcatcaccgccgagcaggccgcgacgatcgtcatcgcc
tacgagccggtgtgggcgatcggcactggccgcaccgcctccgcgcaggacgcccaggac
atgtgcgcggcggtccgcggccagctggccagtcagtacggcgatgagatcgccgcgggg
atccgtgtcctctacggcggctcggtgaaggcagcgaacgccggcgagctgttcaccatg
ccggacgtggacggcgggctggtcggcggggcgagcctggtcgccgaggagttcgtcggc
atcgtgcgcagcgggccgccggcctga

DBGET integrated database retrieval system