KEGG   Frankia sp. CcI3: Francci3_1657Help
Entry
Francci3_1657     CDS       T00320                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fra  Frankia sp. CcI3
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fra00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(1990810..1992342)
Genome map
AA seq 510 aa AA seqDB search
MSVPARGSLVAAVDQGTTGTTVCLLDRDGVVVGRGYTGIRPGFPRPGWVEQDPDELWRSV
VDTVAAALAGCGRRAGELAALGITNQRETTVLWDRRTSAPVHPAIGWQDRRTAAVCERLT
AEGHAGAVGERTGLVLDPYFSGTKIGWILDDDPGLRRRAGRGEIAFGTVDSWLVWKLTAG
AAHVTDVTNASRTLLLDLAAATWSPEMLDLLGVPAEVLPAVAPSSRVYAETDPDAFLGVR
IPVAAVIGDQQAALFAQGCFEPGQAKNTYGTGSFVLVNTGSALPAPQSTLLRTAAFQLDG
EPVRYALEGAVLSTGAAVDWLRDSLGIIRDATETADLAASLTGNDGVYFVPALAGLGAPH
WDPRARGALLGITRGTTRAHVVRAVLEGIAYRTRDVVEAMGAAGFPVRELRADSGAARNH
WLMQFQADLLGVELDVPDNIETTALGSAYLAGLATGFFADREELAGHRRSAERYRPRLSR
AERDRSYRRWLRAVDRARDWAKDADDADWD
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgccggcacgcggatccctggtggcggcggtcgaccaggggaccaccgggacc
acggtctgcctgctcgaccgggacggggtggtcgtcggccgcggctacaccgggatccgg
cccgggttcccccggccgggctgggtcgagcaggatccggacgagctctggcgcagcgtc
gtcgacaccgtcgccgcggccctggccggctgcggtcgccgggccggggagctcgccgcc
ctcggcatcaccaaccagcgcgagaccaccgtgctgtgggaccggcggacctccgccccg
gtccacccggccatcgggtggcaggaccggcggacggccgcggtctgcgaacgcctcacc
gccgaggggcacgcgggtgcggtgggggaacgcaccgggctggtactcgacccctacttc
tccggtaccaagatcggctggatcctggacgacgaccccgggctgcgccggcgcgccggc
cggggggagatcgccttcggcaccgtcgattcctggctggtctggaagctgaccgccggg
gccgcgcacgtcaccgacgtcacgaacgcctcccgcaccctgctgctcgacctcgccgcc
gcgacctggtccccggagatgctcgatctgctgggcgttcccgccgaggtgctgcccgct
gtcgcgccgagctcgcgggtctacgccgagaccgatccggacgccttcctcggcgtgcgg
atcccggtggcggccgtgatcggcgaccagcaggccgctctgttcgcccagggctgcttc
gaacccggccaggccaagaacacctatggcaccggttccttcgtgctggtgaacaccggc
tcggccctgccggcgccgcagtcgacgctgctgcggaccgcggcgttccagctcgacggc
gaaccggtgcggtacgcgctggagggagcggtcctgtccaccggtgccgccgtcgactgg
ctacgggactccctggggatcatccgggatgccaccgagaccgccgacctggccgcctcc
ctgaccggcaacgacggcgtctacttcgtcccggcgctcgccggcctcggcgcccctcac
tgggatccccgcgcccgcggcgcactgctcgggatcacccgggggaccacccgggcgcac
gtcgtccgcgcggtgctcgagggcatcgcctaccgcacccgggacgtcgtcgaggcgatg
ggtgccgcgggcttcccggtgcgcgagctgcgggccgacagcggggccgcccgcaaccac
tggctcatgcagttccaggccgacctgctcggcgtcgagctcgacgtcccggacaacatc
gagacgaccgcgctcggttcggcctacctcgcggggctcgcgaccgggttcttcgccgac
cgcgaggagctcgccgggcatcggcgcagcgccgagcggtaccggccgaggctgtcccgg
gccgagcgggaccggtcctaccggcgatggctgcgcgccgtggaccgggcccgggactgg
gccaaggacgccgacgacgccgactgggactga

DBGET integrated database retrieval system