KEGG   Frankia sp. CcI3: Francci3_1748Help
Entry
Francci3_1748     CDS       T00320                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fra  Frankia sp. CcI3
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Francci3_1748
Enzymes [BR:fra01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Francci3_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2080581..2081159)
Genome map
AA seq 192 aa AA seqDB search
MSLTYPDGRAGLADEVADGTDPLEGLARQLLVEIGEDPGRDGLRETPARYARWWREFVGF
DPGNTETAFEQVNHGQLVQVNDIRVWSLCEHHLLPFWCDISIAYLAKDKLLGLSKFARIA
HHHAHRLQVQERLTGAIADAIEALCGVPDVAVRAKGEHLCMTMRGIRSPATMSTLVLRGV
FKDDPHMRNLLS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgacctatcccgacggacgcgcgggcctcgccgatgaggtggcggacggaacg
gacccgttggaaggtctggccaggcaattgctggtggagatcggtgaggaccccggccgt
gacggtctgcgtgagactccggcccgctatgctcgctggtggcgggagttcgtcgggttt
gaccccggcaacaccgagacagccttcgagcaggttaaccacggacagctggtgcaggtc
aacgacatcagggtgtggtccctgtgtgagcaccacctactgccattctggtgcgacatc
tccatcgcttacctggccaaggacaagctgctggggctgtcgaagttcgccagaatcgcc
caccaccacgcccaccggcttcaggtgcaggaacggctgaccggcgccatcgccgacgcg
atcgaggccctgtgcggtgtgcccgacgtcgcggtacgagccaagggcgagcatctgtgt
atgacgatgcgcggtatacgcagcccggcgacgatgtccactctggtgctacgcggggta
tttaaggatgacccgcacatgcggaacctgctgtcgtga

DBGET integrated database retrieval system