KEGG   Frankia sp. CcI3: Francci3_1819Help
Entry
Francci3_1819     CDS       T00320                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fra  Frankia sp. CcI3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2154800..2156032
Genome map
AA seq 410 aa AA seqDB search
MTIQHEESSTAAAVLRAAMVDELRELGAVRDPRVARALAVVPRHLFAPGADLAAAYAATG
TVVPVRDAVGRMVSTVSAPHIQAMMLEQARVAPGMRVLEVGSAGYNAALLAELVGETGEV
TTVDILPGVAERARRCLDAAGYGRVRVVLADAEGGVPDHAPYDLVLVTTAVRDIPSAWTD
QLAPGGRLVVPLRLRGQTRSVVFEADGGRLVGHDAQVCSFVPLAGAGAFPEQVLALDGDD
VVVRLDDAAPVDVDEVRQALTWPRVKTWSGVHSGEEPFDDLLLWLAVGLENSGLLLARQA
AVTRGTVAHAWSLGMPAVVGKGSLAYFSLSAKVPGRVSREFGVQAQGPAAELLTSQFIER
IRAWKADRPARIEAFPAGTPDAALPAGGVFLDRPHRRVVVSWPSGPEVPV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaccattcagcatgaggagagttccaccgcggctgctgtgttgcgcgcggccatggtt
gacgagctgcgggaactcggcgcggtccgtgacccgagggtggcgcgtgcgttggccgtg
gtgccgcggcatttgttcgcgccgggcgcagatctggcagcggcgtacgcggctacaggg
acggtcgtcccggtgcgcgacgcggtgggtcggatggtcagtacggtgtcggcgccgcac
atccaggcgatgatgctggagcaggcgcgggtggcgccggggatgcgggtccttgaggtc
ggttcggcgggctacaacgcggcgctgctcgcggagctcgtcggcgagacaggcgaggtc
actaccgtcgacattctgcccggggttgccgagcgcgcccggcgttgtctggacgcggcg
ggctatggccgggtgcgggtggtgctggccgacgccgagggtggcgtgcccgaccacgcg
ccctatgacctggtgctggtgacgacggcggtccgtgacattccctccgcgtggacggac
cagctcgcgcccggcggccggctggttgtgccgctgcggctgcggggccagacacgctcg
gtcgtgttcgaggccgacggcgggcggctggttggccacgacgcccaggtctgtagtttt
gtcccgctcgcgggtgctggggctttcccggagcaggtgctggcgttggacggggacgat
gtcgtggtccggctggacgacgcggccccggtggacgtggacgaggtccgccaagcgctg
acctggccgcgggtgaagacctggtcgggtgtccacagcggcgaagaaccgttcgatgac
ctgctgctgtggctcgcggtcggcctggagaactctggtctgctgctggcccggcaggct
gcggtcacgcgggggacagtcgcccacgcgtggagcctcggcatgccggcggtcgtagga
aaaggcagtctcgcctacttctcgctcagtgcgaaggttcccggccgtgtgtcccgcgag
tttggcgttcaggcccagggtcccgccgccgagctgctgacctcccagttcatcgaacgg
atccgcgcgtggaaggccgatcggccggcccgtatcgaggcattccccgcgggtactccg
gacgccgcgctgcccgccggcggcgtgtttctcgatcgccctcatcggcgtgtcgtcgtc
tcctggccgtccggcccggaggttcccgtctga

DBGET integrated database retrieval system