KEGG   Frankia sp. CcI3: Francci3_2034Help
Entry
Francci3_2034     CDS       T00320                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fra  Frankia sp. CcI3
Brite
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Francci3_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 CMAS Ubie_methyltran RrnaAD Methyltransf_11 Methyltransf_23 MTS Methyltransf_3 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: ABD11408
JGI: Francci32034
RhizoBase: Francci3_2034
UniProt: Q2JBD4
Position
complement(2394076..2395302)
Genome map
AA seq 408 aa AA seqDB search
MTSVQDSSATDSAATLRAAMVDELRTTGDAIKTGQVAAAVGRVPRHLFAPDEPLEAVYAA
NKALVIKRDGNGAALSSLSAAHIQAVMLEQAELEPGMRVLEVGSGGYNAALIQEMVGDGG
SVTSVDIDQEIVSRARACLDAAGYRNVEVVAADAEAGVPEKAPYDRIIVTAGAWDIPPAW
QEQLTNGGRLVVPLRLRGLTRSIAFDRVDEDGDVGLVSRSYRLCGFVPMQGIGTFRERLV
PITDEVVLRVDDPSQEFDVEGLRDALATPRLERWSGAAFDLPDELEFFLVTNLAQVAHLH
VDETQVQNGRFAPSAARGVPTLVSGGSFAYRTKRPNEKTGGFESGVVAHGPDADRVAEHY
VELLRRWASDHRRSGAAHIRYVPKAAGTPAPSVGLVPKRHGAVAVRWP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagtccaagattcgagcgccaccgacagtgcggccacgttgcgtgccgcgatg
gtggacgagcttcgcaccacgggggacgcgatcaagactgggcaggtggctgcggctgtg
ggcagggtgcctcggcaccttttcgcacccgacgaaccgctggaggcggtctacgccgca
aacaaagcacttgtgattaaacgcgatgggaatggtgcggcgctcagctcgctgtccgcc
gcgcacattcaggcggtcatgttggagcaggccgaacttgaaccgggaatgcgtgtcctg
gaggttggctcgggcggctacaacgccgccctcatccaggagatggtcggcgacggaggc
tcggtgacgtccgtcgacatcgaccaggagatcgtgagccgggcccgcgcctgtctggac
gcggccggctatcgaaatgttgaagtcgtggcggccgacgccgaggccggcgtacccgaa
aaagcaccctacgaccggattatcgtgaccgcaggggcctgggacatcccaccagcctgg
caggagcagctcacgaacggcggcaggctcgttgtgccgctccggctacgagggctgacc
cggtcgatcgcgttcgaccgggtcgacgaggacggtgacgtcggtctggtcagccgcagc
tatcgcctgtgcggattcgtcccgatgcagggcatcgggacgttccgcgaaaggctcgtc
cctattaccgacgaggtcgtgcttcgggtcgacgacccgtcccaggagttcgacgtcgag
gggctgcgcgacgcgctggccacgccgaggctggaacgctggtccggagcggccttcgat
cttcctgacgagttggagttcttcctcgtcacgaatctggcccaggtcgcgcacctgcat
gtggacgagacgcaggtccagaacggccgcttcgcgccctcggccgccagaggtgtgccc
acgctggtcagcggtggcagtttcgcctaccgcaccaagcgcccgaacgagaagaccggc
ggattcgagagcggcgtcgtcgcgcacggtcccgacgccgatcgcgtcgccgagcactac
gtggaactgctccgccggtgggccagcgatcaccgccgttccggtgccgcccacatccga
tacgtcccgaaggccgcggggacgccggcgccgtccgtggggctggtgccgaaacggcac
ggcgctgtcgctgtccgctggccctga

DBGET integrated database retrieval system