KEGG   Frankia sp. CcI3: Francci3_2103Help
Entry
Francci3_2103     CDS       T00320                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fra  Frankia sp. CcI3
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Francci3_2103
Enzymes [BR:fra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Francci3_2103
Peptidases [BR:fra01002]
 Cysteine Peptidases
  Family C44
   Francci3_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
2469295..2470350
Genome map
AA seq 351 aa AA seqDB search
MDYARLAARHSGIVHRLMPLGAEHAPYSALDVVPVTDEPAPSTIAHARFSGQLAWMRRTF
DTDCHLTGDGGDSLLCSPPIILADLFAIGHSRRAVVETIRWARLRRLPVWPLLRSAHRVS
RERRAAALAALATELGGGSSRSTADGDIGWCGIEPLPSWATLQARERARTVASAVAERTD
DPTPGSFATVMTGEGMAEVGRSARADIQLAEAAGVALHNPFTDSRVVDTYLSVSLGDRPG
PADYKPVLRAAMANLFPARLAERTTKGDFNPDHYQGMRTNLASLHALADGRLAALGLVEP
GEFRQTLTMMAAGLPVPFATVEPALAAEVWLRALGDTSDVAWIPRTTESDR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtggactatgcgcggctcgcggccagacattccggaatcgttcatcgcctcatgccgctg
ggcgcggagcacgcgccgtattctgcgttggatgttgtcccggtaacagacgaaccggcg
ccgtccacgatcgcgcatgcccgattttccggtcaactcgcctggatgcggagaaccttc
gacactgattgccatttgactggcgatggcggggatagcctgctgtgttctccaccaatc
attctggcagatttgttcgcgatcgggcatagccggcgggcagtggtcgaaacgatccga
tgggcgcggttgcgtaggcttcccgtgtggccgctgctgcggtcggctcaccgtgtctcg
cgagaacgtcgcgcggcagcgctggcggcgctggccacggagttgggtggaggttcctca
cgaagtaccgccgatggcgatatcggctggtgcgggatcgaacctcttccctcatgggcg
acgttgcaggcacgggaacgggcacggactgtcgcctcggcggtagctgaacgcacggat
gatcccacccccggttcgtttgccacggtcatgaccggtgaaggaatggcggaggtgggg
cgctccgcgcgcgccgatattcagcttgccgaagcggccggggtagcgctgcacaaccca
ttcacggattctcgcgtggtggatacctatctgtcggtttccctgggtgaccgtcccggc
cccgccgactacaagcccgtgttgcgggctgcgatggcgaacctgttccctgccaggctg
gcagagcgcactaccaagggcgatttcaatcctgaccactaccaggggatgcgcacgaac
ctggcttcgctccatgccctggctgacggccggttggccgctctgggcctcgtcgagccc
ggcgagttccgacagacgttgacgatgatggccgcagggctccctgtcccgttcgccacc
gtggagccggctttggcggcggaggtatggctacgggccctgggtgacacatccgatgtg
gcgtggattccaagaaccacggagagcgatagataa

DBGET integrated database retrieval system