KEGG   Frankia sp. CcI3: Francci3_2299Help
Entry
Francci3_2299     CDS       T00320                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_2299
Enzymes [BR:fra01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Francci3_2299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2679418..2681784)
Genome map
AA seq 788 aa AA seqDB search
MVSVVSILSILSILSAAAGAHDAPATPACLDGVDTVVSFPLSAVVGMDDLRLALLLNAVS
PTLGGILVRGEKGTAKSTAVRGLAALLPPVTVTEGCRFSCAPDAPLPDCPDGPHPAPSPS
LTRPARLVELPVGASEDRLTGSLDLDRALADGVSVLRPGLLAAAHRGLLYVDEVNLLGDH
LVDLLLDAAAFGVAHVERDGVSVRHPAVFLLVGTMNPEEGELRPQLLDRFGLTVHVAASR
DPAVRAEVVRRRLAFEADPAGFAATWADAEAELAARVVAARGRLGTVRLTDAALRAVTAI
CAGCDVDGMRADVVLAKTAMALAAWAGRATVLAADIRTGARLALPHRRRRGPFDAPGMDD
ETLDAVLDEALAALDERVGAEREAGECEADEEAGEEAGGSGAGESGAGESGVPVNDARPD
DDPPDGGGSGGAPRGDGGSHGCDGAGDGNRGAGNGGDDGNGGDDGKGGDSGDGGDRWSAR
PSPSASSTATASSTRLAGAPAAASRPRLLTVAGLGTSSGATGRRSPARGSRGALVTTAAD
APGLHLPATLLAAAPFQAARGRCGPGLVLVPADRRGAVRVGREGNLVLFVVDASGSMAAR
ARMTLVTTAVLALLVDAYQRRDRIGMITFRGSGAEVVLAPTSSVEVGAARLRALPTGGRT
PLAAGLGLAGEVLRAERRRDPTRRALLVVVTDGRATAGDDPLPVARALVRAAGGAAGPAT
GGRAGTGGRGGGRGELSSVVVDCENGFLRLGLAQRLAGALGGVTIPLDSLHHLTPRATPR
ATSGKVAC
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
gtggtatccgtcgtgtcgatcctgtcgatcctgtcgatcctgtcagccgcagccggtgca
cacgacgcaccggcgacacccgcttgcctcgacggcgtcgacaccgtggtgagcttcccg
ctgtcggcggtggtcggcatggacgacctgcgcctggccctgctgctcaacgcggtctcc
cccacgctgggcggaatcctcgtgcgtggggagaagggcaccgccaagtccaccgccgtg
cgcggcttggccgccctgctgcccccggtgacggtcacggagggctgccggttctcctgc
gcgcccgacgcgccgttaccggactgccccgacggcccgcatcccgcgccgtcgccgtca
ctgacccgtccggcccggctggtggaactacccgtgggcgcctccgaagaccggctaacc
ggttccctcgacctggaccgggcgttggccgacggggtcagcgttctgcgcccgggtctg
ctcgccgccgcccaccgcgggctgctctacgtcgacgaggtcaacctgctgggggaccat
ctcgttgacctgcttctcgacgccgccgccttcggggtcgcccacgtcgaacgcgacggg
gtgtcggtgcgccatccggcggtgttcctgctggtcgggacgatgaacccggaggagggc
gagctgcgtccgcagctgctcgaccggttcgggctgaccgtgcacgtcgcggccagccgt
gacccggcggtgcgcgcggaggtcgtccgccgacggctggcgttcgaagccgacccggcc
gggttcgccgcgacctgggcggacgcggaggcggaactcgcggcccgggtcgtcgccgcc
cgcggccggctcggcacggtccggctcaccgacgcggcgctgcgggccgtcaccgccatc
tgcgccggctgcgacgtcgacggcatgcgcgccgacgtggtgctggccaagaccgcgatg
gcactcgccgcgtgggcggggcgcgccacggtgctcgccgccgacatccgtaccggtgcc
cgtctcgcgctaccgcatcgccgccgccgcggcccgttcgacgcccccggaatggacgac
gagaccctcgacgccgtcctcgacgaggccctggccgctctcgacgagcgcgtcggggcc
gaacgcgaggccggcgaatgtgaagccgacgaagaagccggcgaagaagccggcggatcc
ggtgccggggaatccggtgccggggaatccggggtaccggtgaacgatgcgcgccccgat
gacgacccgcccgacggcggcggttcggggggcgcgccccgtggtgacggcggttcccac
ggctgcgacggtgcgggggatgggaaccgcggcgcggggaacggcggggatgacgggaac
ggcggggatgacgggaagggcggggacagcggggacggcggggaccggtggtcggcacga
ccgtccccgtcggcgtcttcgaccgcgacggcgtcttcgacccggctcgccggcgcaccg
gcggcggcgagccggccgcggctgctcaccgtcgccggcctcggaacctcctcgggagcc
accggacgtcgatccccggcccgcggcagccgcggcgcgctcgtcaccaccgccgcggac
gcacccggcctgcatctgccggcgaccctgctcgccgccgccccgttccaggccgcccgc
ggccggtgcggacccggcctcgtgctggtcccggcggaccgccgtggcgccgtgcgcgtc
ggccgggagggcaacctggtgctgttcgtcgtcgatgccagcgggtcgatggccgcccgc
gcgcggatgaccctggtcaccacggccgtgctggccctgctcgtcgacgcctaccagcgc
cgcgaccggatcgggatgatcactttccgggggtcgggagcggaggtggtgctcgcgccg
acctcgagcgtggaggtgggcgcggcccggctgcgcgcgctgcccaccggcgggcggacc
ccgctggccgccgggctgggcctcgccggtgaggtcctgcgcgccgaacggcgccgtgat
ccgacgcggcgggccctgctcgtggtcgtcaccgacggccgggcgaccgccggggacgac
ccgctgccggtggcccgcgcgctggtgcgcgccgccggtggcgcggccggaccggcgacg
ggcggacgggccggtaccggggggcgtggcggcggccggggtgagttgagcagcgtcgtc
gtcgactgcgagaacggtttcctgcgcctgggcctggcccagcggctcgcgggcgccctc
ggcggcgtcacgatcccgctggactccctgcaccatctcactccccgcgcgacgccccgc
gcgacgtccggaaaggtggcctgttga

DBGET integrated database retrieval system