KEGG   Frankia sp. CcI3: Francci3_2486Help
Entry
Francci3_2486     CDS       T00320                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_2486
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_2486
   00020 Citrate cycle (TCA cycle)
    Francci3_2486
   00620 Pyruvate metabolism
    Francci3_2486
Enzymes [BR:fra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Francci3_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2932143..2933435)
Genome map
AA seq 430 aa AA seqDB search
MAAVREFPLPDLGEGLTSAEVVRWLVGVGDVITVDQPVAEVETAKAVVEVPCPYAGVVTS
LAGLAGTSVPVGTPLITVAVSEPAAGRTGSGNILVGYGTSTEPPRTRRRRRVGAPGAPPV
PALTPTPGPATPLGPSAQTVVKVVSPLVRRFARENSVDLRKLVGTGPDGLILRKDVESAI
APRSAPSRPAETDSTVVPLDPLARRAAETFARSRREVPDATCWVDTDATALLAAKDTLND
TRNAGGAEPRIGLLAILARICVAALVRFPALNSAVVTDADGRATGVRHHAAVHLGFAAQT
PRGLVVPVVHHAQGLTTARLAAEIARLTAAARAGTLTPAELTGGTFTLNNYGVFGVDGST
PIIHHPEAAMIGIGRIVPRPWAVDGELAVRRIVQLSFTFDHRVCDGATAGSFLRFVADAV
EDPTVLLRHL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcggtacgcgaattccccctccccgacctcggcgagggcctgacctccgccgag
gtcgtccgctggcttgtcggcgtcggggacgtcatcaccgtcgaccaacccgtagccgag
gtcgagaccgccaaagccgtcgtcgaggtgccctgcccctacgccggcgtcgtcacctcc
ctcgcgggcctggccggtaccagtgtcccggtcggcacaccactgatcaccgtggccgtc
agcgagccggcagcagggcgaacgggctccgggaacatcctcgtcggttacggcaccagc
acggaacccccccgaacccgccgccgacgacgcgtcggcgctcccggagcgccccccgta
ccggcgctcaccccgactcccggaccggcgacgccactcgggccttccgcccagaccgtg
gtcaaggtcgtctcgcccctcgttcgccgcttcgcccgcgagaactccgtcgatctccga
aaactcgtcggcaccggcccggacgggctgattctgcgcaaggacgtggagagtgccatc
gccccgcgttccgctccgtcgcgcccggcggagaccgactcgaccgtcgtcccgctggac
ccgctggcgcggcgcgcggcggagacgttcgcgcgcagcaggcgcgaggtgccggacgcc
acctgctgggtcgacacggatgccaccgcgctgctcgccgccaaggacaccctcaacgac
acccgcaacgctgggggcgccgagcccagaatcggtctcctggcgatcctggcccgcatc
tgcgtcgccgccctggtccgctttcccgcactcaactccgccgtcgtcaccgacgcggac
ggccgcgcgaccggcgtgcgccaccacgccgccgtccacctgggattcgccgcccagacc
ccgcgcggcctggtcgtgcccgtggtgcaccacgctcagggcctgaccaccgctcgactg
gccgccgagatcgcccggttgaccgccgccgcccgcgcgggcacgctcactcccgccgag
ttgaccggcggcacgttcacgctcaacaactacggcgtcttcggtgtcgacggctccacg
cccatcatccaccaccccgaggccgcgatgatcggcatcggccggatcgtccccaggccc
tgggcggtggacggcgaactggcggtccgcaggatcgtgcagctttcgttcacctttgac
caccgagtctgcgacggcgccaccgccgggtcctttctgcgcttcgtcgccgacgcggtc
gaagaccccacggtgctgctgcgccacctctga

DBGET integrated database retrieval system