KEGG   Frankia sp. CcI3: Francci3_2514Help
Entry
Francci3_2514     CDS       T00320                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
fra  Frankia sp. CcI3
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Francci3_2514
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Francci3_2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(2971117..2972142)
Genome map
AA seq 341 aa AA seqDB search
MRAVQVIKYDNAPRLVDVPEPKILHPLDVVVRIGGAGVCRTDLHIIEGQWEQKSGVTLPY
VLGHENAGWVHEVGSAVSDIAVGDPVILHPLVTCGLCRACRDGDDVHCARASFPGIDSDG
GYAELLRTNARSVVKLDPSLQPADVAALADAGLTAYHAARKAAAALSPGDRVVVIGAGGL
GHIGVQVLRALTPAEIIVVDRSAEALRLAGELGADHTVRADGSEVSAVLDLTGGSGAEAV
IDFVGEGGAIEAGVAMLRRAGSYYVVGYGGVLNVSTIDIISTEINFIGNLVGSYSDLVEL
MVLATRGKVTLHTSAYPLAEFHQALDDLHHGKVRGRAILIP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagggccgtccaggtcatcaagtacgacaacgcgccgcggctggtagacgtccccgag
cccaagatcctccatccgctggacgtggtggtcaggatcggcggcgccggtgtctgtcgg
accgacctgcacatcatcgaagggcagtgggagcagaagtcgggcgtgaccctgccgtac
gtgctcggccacgagaacgccggctgggtgcacgaggtcggttcggcggtgagcgacatc
gccgtgggcgacccggtcatcctgcacccgctggtcacctgcgggctatgccgggcctgt
cgggacggcgacgacgtgcactgcgcccgggcgtcctttcccggaatcgacagcgacggc
ggctacgccgaactgctgcggaccaacgcccggtcggtggtcaaactcgacccgtcgttg
caaccggcggatgtggcggcactggccgacgccggactgaccgcctatcacgcggcacgc
aaggcagccgcggcgctgagtcccggtgaccgggtcgtggtgatcggagccggcggtctg
ggccacatcggtgtgcaggtgctgcgtgccctcaccccagccgagatcatcgtcgtcgac
cgctccgccgaggcgttgcggctcgccggcgaactgggcgccgaccacacggtgcgggcc
gacggcagcgaggtgtccgcggtactcgatctcaccgggggcagcggcgccgaggcagtc
atcgactttgtcggcgaaggcggtgcgatcgaggcgggtgtcgccatgctgcgtcgcgcc
ggttcgtattatgttgtcggctatggcggggtgctgaacgtctccaccatcgacatcatt
tccactgagatcaacttcatcggtaacctggtcggatcgtacagcgacctcgttgagctg
atggttctcgcaacccgtggcaaggtcaccctgcacacgagtgcctaccccctggcagag
ttccaccaggcgctcgacgaccttcaccacggcaaggtgcgcggtcgggcgatcctgatc
ccctga

DBGET integrated database retrieval system