KEGG   Frankia sp. CcI3: Francci3_2673Help
Entry
Francci3_2673     CDS       T00320                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
fra  Frankia sp. CcI3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH TPR_12 Kdo RIO1 Kinase-like TPR_19
Motif
Other DBs
NCBI-ProteinID: ABD12035
JGI: Francci32673
RhizoBase: Francci3_2673
UniProt: Q2J9K7
Position
complement(3155236..3156858)
Genome map
AA seq 540 aa AA seqDB search
MPWPMPFPGGGSVPGDRAGRDGGTVAARWMIDRRYELEAVPLAKGGMGEVWVGRDVKLDR
EIAVKFVRFPDGQPDQELIRRFIRESRITARLLHPGVPAVYDAGTHEERPYLVMQRVHGL
SVADLVAEQGALPVGWAAAIAAQVASVLAVAHRASLVHRDLKPANLMLEPDGTVKVLDFG
LAVALDRTNLSKITVTGQHLGSPAYMAPEQVLAGLSTPATDIYALGATLFEMLTGQRLFA
GASSYTVMNKQVEEVPARVRSLRADVPRGLDELVAAMLSKAPEDRPCGVEKVYAALIGSV
VDLGPLPGAVDDAVDNPVRMYAAVAGRVVPRGAARNTAASTRGSAAGPPGESGGGVGRSE
LRRARDEARTLARASRYSQAAGVLAAAVDRAGRALGHDSADVLALRLDLADHLFEGGDFR
RAVDGYRTLLVDLVHRDAPDSERVLRCRLREATCRTLIGETGQALEQLRGLLEDEIRVFG
ADDAQVFELRRQIGLLQLGAGHRASATETLSALLADLLRVWGMEHPMVPVVRELLAGAVG
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggccgatgccgtttccgggtgggggtagtgttcccggggatcgggcgggaagg
gacgggggcacggtggccgcgcggtggatgatcgacaggcggtatgagctcgaggctgtt
ccattggccaagggcggaatgggtgaggtctgggtcggccgggatgtgaaactcgaccgg
gagatcgcggtcaagttcgtccgttttcccgacggccagcccgaccaggagctgatccgc
cggttcatccgggagtcccgcatcaccgcccgcctgctgcatccgggggtgccggcggtg
tacgacgcgggtacccacgaggagcgtccctacctggtcatgcagcgggtgcacggcctc
agcgtggcggatctcgtcgccgagcaaggcgcgctgcccgtcggctgggccgccgcgatt
gccgcccaggtggcctcggtgctcgcggtggcgcatcgggcgtcgctcgtgcaccgcgac
ctcaaaccggcgaatctgatgctggagccggacggtaccgtgaaggtgctggacttcggg
cttgccgttgcgctcgaccggaccaacctgtcgaagatcacggtgaccggccagcacctc
ggcagccctgcctacatggcgcccgagcaggtgcttgccggcctgagcacgcccgccacc
gacatctacgcgctgggtgccacgctgttcgagatgttgaccggtcagcggctgttcgcc
ggtgcgtcgtcctacacggtgatgaacaagcaggtcgaggaggtcccggcgcgggtgcgg
tcgctgcgcgccgacgtgccgcgcggcctcgacgagctggtcgccgcgatgctgagcaag
gcaccggaggatcgcccgtgcggcgtggagaaggtgtacgcggcgttgatcggatccgtg
gtggacctcggcccgcttcccggggccgtcgacgacgccgtggacaacccggtacggatg
tacgcggcggtcgcgggccgggtggtaccgcgcggggcggcccggaacaccgccgcctcc
acacggggatccgccgctggaccgcccggggaatccggtggcggggtcgggcggtccgag
cttcgtcgtgcccgggacgaggctcggacgttggcccgggcttcccgctacagccaggcc
gccggtgtgctggcggcggcggtggaccgggccggtcgtgccctcggccacgacagcgcg
gacgtgctcgcgctccgtctcgatctggcggaccacctgttcgagggcggtgacttccgc
cgcgccgtggacggctaccgcacgcttctcgtcgatctcgtccaccgggacgctccggac
agcgagcgggttctgcgctgccgtctgcgggaggcgacctgccggaccctgatcggtgag
accggccaggcgctcgaacagcttcgtgggctgctggaggacgagatcagggtgttcggt
gcggacgacgcccaggtcttcgagctgcgacggcagatcgggctgttgcagctcggcgcc
ggccatcgggcgtcggccaccgagaccctatcggcgctgctcgccgatctgctcagggtc
tgggggatggagcatccgatggtgcccgtcgtccgggagctgctggccggtgccgtcggt
tga

DBGET integrated database retrieval system