KEGG   Frankia sp. CcI3: Francci3_2843Help
Entry
Francci3_2843     CDS       T00320                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fra  Frankia sp. CcI3
Pathway
fra00010  Glycolysis / Gluconeogenesis
fra00030  Pentose phosphate pathway
fra00051  Fructose and mannose metabolism
fra00052  Galactose metabolism
fra00680  Methane metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
fra01230  Biosynthesis of amino acids
fra03018  RNA degradation
Module
fra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_2843
   00030 Pentose phosphate pathway
    Francci3_2843
   00051 Fructose and mannose metabolism
    Francci3_2843
   00052 Galactose metabolism
    Francci3_2843
  Energy metabolism
   00680 Methane metabolism
    Francci3_2843
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Francci3_2843
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Francci3_2843
Protein phosphatases and associated proteins [BR:fra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Francci3_2843
Messenger RNA biogenesis [BR:fra03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Francci3_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABD12201
JGI: Francci32843
RhizoBase: Francci3_2843
UniProt: Q2J941
Position
complement(3350156..3351493)
Genome map
AA seq 445 aa AA seqDB search
MGAPILVDNADLAVKTLGVCRIDSPLLPLLGERPTTQHYIDESDKVLYDDTALMISSRGV
ALDDLPGFEPAGPRRKIYFDPSKTRVGIVTCGGLCPGLNNVIRGLVLELTSHYRVRRIFG
FRNGYQGFIARYGHDVVDLTPESVANIDEDGGTILGSSRGQQDPAEIVDCLSRMNINILF
VIGGDGTLRGAGQIAREAETRGEKIAVVGIPKTIDNDIPYIDQSFGFQTAFGKAAESIRV
AHAEATSAPGGLGVVRLMGRHSGFIACYATLAKSNADVVLIPELPFKLEGDGGLLNYVRR
RVAERGHAVVVVAEGAGQELVVGQPESTDASGNRKLHDIGPELSRRIKEYFDAEGIELNL
KYIDPSYVIRSVPANPYDSVYTIRLAHAAVHAAMSGRTEMVVGRWRRRFIHIPIPLAISQ
RNQVDPAGDLWMSVLEATGQPPRFE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcaccaatactggtggataatgccgatctggcggtcaagaccctgggggtctgc
cggattgactccccgctcctgccgctgctgggggagcggccgacgacgcagcattacatc
gatgagtcggacaaggtcctctacgacgacaccgccctgatgatctcctcgcgtggtgtc
gcgctcgatgacctgcccggattcgagccggccgggccgcgccggaagatctacttcgac
ccgtcgaagacccgggtgggcatcgtcacctgcggtgggctctgtcccgggttgaacaac
gtgatccgcggtctggtgctggagctgacctcgcactaccgggttcggcggatcttcgga
ttccgcaacgggtaccagggcttcatcgcccgctacggccacgacgtcgtcgatctcacc
ccggagagcgtcgccaacatcgacgaggacggcgggacgatcctcggcagttcccgcggc
cagcaggatcccgccgagatcgtcgactgcctctcccggatgaacatcaacatcctgttc
gtcatcggcggtgacggcaccctgcgcggggccgggcagatcgcccgggaggccgagacg
cgcggggagaagatcgccgtggtcggcatcccgaagacgatcgacaatgacatcccctac
atcgaccagagcttcggcttccagacggccttcggcaaggccgcggagtccatccgggtc
gcgcacgccgaggcgacgtccgcgcccggcgggctcggcgtggtccggctcatgggccgc
cactcgggattcatcgcctgctacgcgacgctggcgaagagtaacgcggacgtggtgctc
atcccggagttgccgttcaagctggagggcgacggcggtctgctgaactacgtgcgtcgc
cgggtggccgagcgcggccacgccgtcgtcgtcgtcgccgagggtgccggccaggagctt
gtcgtcggccagccggagagcaccgacgcgtccgggaaccgcaagctgcacgacatcggc
ccggagctctcccgccggatcaaggagtacttcgacgccgagggcatcgagctcaacctg
aagtacatcgatcccagctacgtgatccgcagcgtgccggcgaacccgtacgacagcgtc
tacacgatccggctcgcccacgcggccgtgcacgccgcgatgtccggccgcacggagatg
gtcgtcggccgctggcggcggcggttcatccacatcccgatcccgctcgcgatcagccag
cgcaaccaggtcgacccggccggcgatctgtggatgtccgtcctcgaagcgaccggccag
cccccccgcttcgaatag

DBGET integrated database retrieval system