KEGG   Frankia sp. CcI3: Francci3_2843Help
Entry
Francci3_2843     CDS       T00320                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_2843
   01230 Biosynthesis of amino acids
    Francci3_2843
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_2843
   00030 Pentose phosphate pathway
    Francci3_2843
   00051 Fructose and mannose metabolism
    Francci3_2843
   00052 Galactose metabolism
    Francci3_2843
  Energy metabolism
   00680 Methane metabolism
    Francci3_2843
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Francci3_2843
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Francci3_2843
Protein phosphatases and associated proteins [BR:fra01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Francci3_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3350156..3351493)
Genome map
AA seq 445 aa AA seqDB search
MGAPILVDNADLAVKTLGVCRIDSPLLPLLGERPTTQHYIDESDKVLYDDTALMISSRGV
ALDDLPGFEPAGPRRKIYFDPSKTRVGIVTCGGLCPGLNNVIRGLVLELTSHYRVRRIFG
FRNGYQGFIARYGHDVVDLTPESVANIDEDGGTILGSSRGQQDPAEIVDCLSRMNINILF
VIGGDGTLRGAGQIAREAETRGEKIAVVGIPKTIDNDIPYIDQSFGFQTAFGKAAESIRV
AHAEATSAPGGLGVVRLMGRHSGFIACYATLAKSNADVVLIPELPFKLEGDGGLLNYVRR
RVAERGHAVVVVAEGAGQELVVGQPESTDASGNRKLHDIGPELSRRIKEYFDAEGIELNL
KYIDPSYVIRSVPANPYDSVYTIRLAHAAVHAAMSGRTEMVVGRWRRRFIHIPIPLAISQ
RNQVDPAGDLWMSVLEATGQPPRFE
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgcaccaatactggtggataatgccgatctggcggtcaagaccctgggggtctgc
cggattgactccccgctcctgccgctgctgggggagcggccgacgacgcagcattacatc
gatgagtcggacaaggtcctctacgacgacaccgccctgatgatctcctcgcgtggtgtc
gcgctcgatgacctgcccggattcgagccggccgggccgcgccggaagatctacttcgac
ccgtcgaagacccgggtgggcatcgtcacctgcggtgggctctgtcccgggttgaacaac
gtgatccgcggtctggtgctggagctgacctcgcactaccgggttcggcggatcttcgga
ttccgcaacgggtaccagggcttcatcgcccgctacggccacgacgtcgtcgatctcacc
ccggagagcgtcgccaacatcgacgaggacggcgggacgatcctcggcagttcccgcggc
cagcaggatcccgccgagatcgtcgactgcctctcccggatgaacatcaacatcctgttc
gtcatcggcggtgacggcaccctgcgcggggccgggcagatcgcccgggaggccgagacg
cgcggggagaagatcgccgtggtcggcatcccgaagacgatcgacaatgacatcccctac
atcgaccagagcttcggcttccagacggccttcggcaaggccgcggagtccatccgggtc
gcgcacgccgaggcgacgtccgcgcccggcgggctcggcgtggtccggctcatgggccgc
cactcgggattcatcgcctgctacgcgacgctggcgaagagtaacgcggacgtggtgctc
atcccggagttgccgttcaagctggagggcgacggcggtctgctgaactacgtgcgtcgc
cgggtggccgagcgcggccacgccgtcgtcgtcgtcgccgagggtgccggccaggagctt
gtcgtcggccagccggagagcaccgacgcgtccgggaaccgcaagctgcacgacatcggc
ccggagctctcccgccggatcaaggagtacttcgacgccgagggcatcgagctcaacctg
aagtacatcgatcccagctacgtgatccgcagcgtgccggcgaacccgtacgacagcgtc
tacacgatccggctcgcccacgcggccgtgcacgccgcgatgtccggccgcacggagatg
gtcgtcggccgctggcggcggcggttcatccacatcccgatcccgctcgcgatcagccag
cgcaaccaggtcgacccggccggcgatctgtggatgtccgtcctcgaagcgaccggccag
cccccccgcttcgaatag

DBGET integrated database retrieval system