KEGG   Frankia sp. CcI3: Francci3_2945Help
Entry
Francci3_2945     CDS       T00320                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Francci3_2945
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_2945
  Lipid metabolism
   00071 Fatty acid degradation
    Francci3_2945
  Amino acid metabolism
   00350 Tyrosine metabolism
    Francci3_2945
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Francci3_2945
   00626 Naphthalene degradation
    Francci3_2945
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Francci3_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
3479285..3480295
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTDFRAPLRIEDRDVPVPGPGQILVRMEASGLCHTDIHAAHGDWPVKPTPPFVPG
HEGVGVVKAVGAGVTGRAIGDRVAIPWLGHACGRCRYCVGGWETLCESQRNSGYSIDGAF
AEYAVADADYTVPVPGDVPSFDAAPLTCAGVTTYKAIKVAGVTPAETVAVFGIGGLGHLA
LQYARIAGGFTVGVDVTEAKLELATELGADHVVNARTADPVEAIQRLGGADVAVALAASP
RSFEQAFASLRRGGRLVCVALPADGTMSIPIFDTVLKGITVKGSIVGTRNDLAEVFRLHA
AGRTRVIASGRKLDDVNACMDEVLDSRVPARLVFEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcagttgtcaccgatttccgggcaccgttgcgtatcgaggaccgggacgtc
ccggtgccggggccgggccagatcctggtacggatggaggccagcggtctgtgccacacc
gacatccacgcggcgcacggtgactggccggtgaagccgactcccccgttcgtccctggt
cacgagggcgtcggcgtggtcaaggccgtgggcgccggggtgaccgggcgcgcgatcggc
gaccgggtcgcgatcccgtggctcggtcacgcctgcggacgctgccgctactgcgtcggc
ggctgggagacgctgtgcgaaagccagcgcaacagcggctactcgatcgacggtgcgttc
gccgagtacgcggtggccgacgcggactacacggtgccggtgcccggtgacgtgccgtcg
ttcgacgccgcgccgctgacctgcgccggcgtgaccacctacaaggccatcaaggtagcc
ggggtgaccccggccgagacggtggccgtgttcggcatcggcgggctgggccacctggcg
ttgcagtacgcccgcatcgcgggtggtttcaccgtcggggtcgacgtcaccgaggccaag
ctggagctggccaccgaactgggcgccgaccacgtggtgaacgcgcggaccgccgacccg
gtcgaggccatccagcggctgggcggcgccgacgtggcggtcgcgctcgccgcgtcgccc
cgttcgttcgagcaggcgttcgcctcgctgcggcgcggcggccggctggtctgcgtggcc
ctgccggcggatggcacgatgtccatcccgatcttcgacacggtcctgaaggggatcacg
gtcaagggatcgatcgtcggcacccgcaacgatctggccgaggtgttccggctgcacgcg
gccggccggaccagggtgatcgcttccggccggaagttggacgacgtcaacgcctgcatg
gacgaggtcctggacagcagggtcccggcccggctggtgttcgagttctga

DBGET integrated database retrieval system