KEGG   Frankia sp. CcI3: Francci3_2948Help
Entry
Francci3_2948     CDS       T00320                                 

Definition
(GenBank) NAD(P) transhydrogenase, beta subunit
  KO
K00325  NAD(P) transhydrogenase subunit beta [EC:1.6.1.2]
Organism
fra  Frankia sp. CcI3
Pathway
fra00760  Nicotinate and nicotinamide metabolism
fra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Francci3_2948
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.2  NAD(P)+ transhydrogenase (Re/Si-specific)
     Francci3_2948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNTB TPP_enzyme_M YL1_C
Motif
Other DBs
NCBI-ProteinID: ABD12306
JGI: Francci32948
RhizoBase: Francci3_2948
UniProt: Q2J8T6
Position
3482058..3483479
Genome map
AA seq 473 aa AA seqDB search
MSGSDTAIRLLFLAAASCFVLGLHLMNSPATARRGNQLSAAGMVAAVGTAVGLLARDGVI
TATGLIVLIAGVLLGSGAGLYAARTVRMTAMPQLVSVFNAVGGGAAALVAFAEVARLGGA
AGLAGASGQTTVTVGLDVVIGAVTFSGSLVAAGKLQGLISGAPVLFRGARLLNAALAAVA
VTGVAAIVAGHGGTIALSIVAAAALGLGVTMVLPIGGADMPVVISLLNAFTGTAVAMAGF
VLDSTVLVIAGALVGASGSILTVLMAEAMNRSIPAIIVGGFGTADSTGNAGAAASAPVRS
VAADDAALQLAYASKVIIVPGYGLAAARAQHEVVELADLLTQHGVDVCYAIHPVAGRMPG
HMNVLLAEAHVPYPQMKELAEVNPEFAQADVALVVGANDVTNPAARRPGNAISGMPILDV
DQAKSVIVIKRSMGHGYAGIDNELYTDPKTGMLFNDAKAGLSALTAAMKTLVH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctcggacacggcgatccgcctgctgttcctggccgcggcgagctgcttcgtc
ctcggcctgcacctgatgaactcgcccgcgaccgcccgccggggcaaccagctgtccgcg
gccgggatggtggcggccgtcgggaccgccgtcgggctgctggcccgggacggcgtcatc
accgctaccggcctgatcgtcctgatcgccggtgtgctcctgggatccggcgcgggcctg
tatgcggcgcggaccgtgcggatgaccgcgatgccgcagctggtcagcgtgttcaacgcg
gtcggcggcggcgcggcggcgctcgtcgcgttcgccgaggtggcgcggttgggcggcgcg
gccgggctggccggggcctccggtcagaccaccgtgaccgtcggcctcgacgtcgtcatc
ggcgcggtgaccttctccggctcgctggtggccgccggcaagctgcagggcctgatcagt
ggcgcgccggtgctgttccgcggcgcccgactactgaacgccgcgctggccgcggtcgcc
gtgaccggcgtggcggcgatcgtcgctggtcacggtgggacgatcgcgctgtcgatcgtc
gcggccgccgcgctgggcttaggcgtgacgatggtgctgccgatcggcggcgcggacatg
ccggtggtgatctcgctgctgaacgcgttcaccgggacggccgtggcgatggccggtttc
gtgctcgacagcaccgttctcgttatcgcgggcgcgctggtgggggcgtccggctccatc
ctcaccgtgctgatggccgaggcgatgaaccggtcgatcccggccatcatcgtcggtggt
ttcggcaccgcggactcgaccggaaacgccggcgcggcggcctcggccccagtgcggtcg
gtcgcggcggacgacgcggccctgcagctggcgtacgcgtcgaaggtcattatcgtgccc
ggctacgggcttgcggcggcgcgggcccagcatgaagtagtcgagctcgccgacctgctc
acgcagcacggggtggacgtctgctacgcgatccacccggtcgccggcagaatgccgggc
cacatgaacgtgctgctggccgaggcgcacgtcccctatccgcagatgaaggaactggcc
gaggtcaaccccgagttcgcgcaggccgatgtcgccctggtcgtcggcgccaacgacgtg
accaacccggcggcccgccgtcccggcaacgcgatctccggtatgccgatcctcgacgtc
gaccaggcgaagagcgtcatcgtcatcaaacgctccatgggccacggctacgccggcatc
gacaacgagctgtacaccgacccgaagaccggaatgctcttcaacgacgcgaaagccggc
ctgagcgcgctcaccgccgccatgaagacactcgtgcactga

DBGET integrated database retrieval system