KEGG   Frankia sp. CcI3: Francci3_3016Help
Entry
Francci3_3016     CDS       T00320                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fra  Frankia sp. CcI3
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Francci3_3016
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Francci3_3016
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Francci3_3016
Enzymes [BR:fra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Francci3_3016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3582171..3583508)
Genome map
AA seq 445 aa AA seqDB search
MTTRTAAESVRPAAAGTGTPSGSGPVRPDTSSWQAFPDSSGHFGRFGGRFVPEALMAALD
ELTAAYAAARVDPGFTAELDGLLASYAGRPTPLTDAHRLTAHVGGARILLKREDLAHTGS
HKINNVLGQCLLTRRMGKTRVIAETGAGQHGVATATACALLGLDCVVYMGEEDTRRQALN
VARMRLLGAEVVAVTSGSRTLKDAINEAMRDWVATVDTTHYCIGSVMGPHPFPMLVRDFQ
RIIGVEARAQVLDRVGRLPDAVVACVGGGSNAMGIFHPFIPDVEVALIGCEAGGDGVATG
RHAAAIAGGSAGVLHGMRTFLLQDEFGQTQVSHSISAGLDYPGIGPEHALLHETGRASYR
VVDDTAAMEALALVARTEGILVAIESAHAFAGALDVARKLGPGTTVVVNCSGRGDKDVDT
AARWFDLLDEADAGGGPVGGPARPV
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacccgaaccgctgccgagtcagttcgccccgcggccgccggaaccgggacgccg
tcgggctccggtccggtccgtccggacacgtcgagctggcaggcgttccccgactcttcg
gggcacttcgggcgtttcggtggtcgtttcgtccccgaggccctcatggcggcgctggac
gagctcaccgcagcctacgcggcggccagggtggatcccggcttcaccgcggaactggac
gggctgctggcgagctacgcgggccggcccactccgctcaccgacgcccaccggctcacc
gcgcacgttggcggtgcccgcatcctgctcaagcgtgaggatcttgcgcacaccggttcc
cacaagatcaataatgtcctcgggcagtgcctgctgacccggcggatgggcaagacccgg
gttatcgccgagaccggagccggtcagcacggtgttgccacggccaccgcctgcgccctg
ctcggcctggactgcgtcgtctacatgggcgaggaggacacccgccggcaggccctaaac
gtcgcccggatgcgcctgctcggcgccgaggtcgttgcggtcacctccggcagccgaacc
ttgaaggacgccatcaacgaggccatgcgcgactgggtggccaccgttgacacgacccat
tactgcatcgggtcggtgatgggcccgcatccgttcccgatgctggtccgcgacttccag
cggatcatcggggtcgaggcgcgcgcccaggtgctcgatcgtgtcggccgactgcccgac
gccgtcgtcgcctgcgtcggtggcggctcgaacgcgatgggcatcttccacccgttcatc
cccgacgtcgaggtcgcgctgatcggctgcgaggccgggggggacggggtcgccaccggt
cggcacgccgcggcgatcgccggcggttccgcgggcgtgctgcacggcatgcggacgttc
ctgctgcaggacgagttcgggcagacccaggtctcccactcgatctcggcgggtctggac
taccctggcatcggccccgagcatgccctgctgcacgagaccggtcgggcgagctatcgg
gtcgtggacgacaccgccgcgatggaggcgctcgcgctggtggcccgtaccgagggcatc
ctggtcgcgatcgagagcgcgcacgccttcgcgggtgccctcgacgtcgcccggaagctc
ggtccgggcacgactgtcgtcgtcaactgctccggtcggggggacaaggacgtcgacacc
gccgcccgctggttcgacctcctcgacgaggccgatgccggcgggggccccgtcggcggt
ccggcgcgaccggtctga

DBGET integrated database retrieval system