KEGG   Frankia sp. CcI3: Francci3_3027Help
Entry
Francci3_3027     CDS       T00320                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fra  Frankia sp. CcI3
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Francci3_3027 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Francci3_3027 (hisD)
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Francci3_3027 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3592383..3593678)
Genome map
AA seq 431 aa AA seqDB search
MLRRLDLRGAVPAAAEIRRLLPRADVDVDVAVDAVRPVCADVRDRGDAAVLAAAERFDGV
RPPSLRVPAQVLAAAADVLDPAVRDALTEAIRRTRLVHRAQLREPVAIEVAPGTTVTQRW
VPVERVGLYVPGGRVAYPSSVVMNVVPAQEAGVGSLAVFSPPQKDNGGLPHPVILAACAL
LGVEEVYAAGGAQAVAMAAYGTTSCPPVDVITGPGNVYVTAAKRLLRGVVGVDAEAGPTE
VAILADATADPAFVAADLIAQAEHDPMAACLLITPSVELADAVDVELGKQVPATRHRERV
AESLAGQGAVALVADVDAGLAVADGWAAEHLEIHTADAAAVAARVRHAGAVFVGDYAPVP
LGDYLAGSNHVLPTGGTARHSSGLAVTAFQRQVQVVECTREGLAAVAPRIAALGGAEDLT
AHVDAVEVRLR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagaaggcttgatctgcgtggcgcggtgcctgccgcagccgagatccgacggcta
ctgccgcgggccgacgtcgacgtcgacgtcgccgtcgatgcggtccggccggtctgtgcg
gacgtgcgggaccgcggcgacgcggccgtcctcgccgccgcggagcggttcgacggggtc
cgcccgccgagcctgcgggtgcccgcccaggttctcgccgccgccgcggatgtcctggat
ccggccgtgcgcgacgcgctgaccgaggcgatccgccggactcggctggtgcaccgtgcg
cagctgcgggagccggtggcgatcgaggtcgcgcccggcaccacggtgacgcagcgctgg
gtgccggtggagcgggtcggcctgtacgtgccgggcgggcgggtcgcctaccccagcagc
gtcgtgatgaacgtcgtgcccgcccaggaggccggggtcggctcgctcgcggtcttctcc
ccgccgcagaaggacaacggcgggctgccgcatccggtgatcctcgccgcctgcgcgctg
ctcggtgtcgaggaggtctacgcggccggcggagcccaggccgtggcgatggccgcctac
gggaccacgagctgcccgccggtcgatgtgatcaccgggcccggcaacgtctacgtcacg
gcggccaagcgcctgctgcgtggggtcgtcggggtggacgccgaggcgggcccgaccgag
gtcgcgatcctcgccgacgccaccgcggatccggccttcgtcgcagccgacctcatcgcc
caggccgagcacgacccgatggccgcctgcctgctgatcaccccgtcggtggaactcgcc
gacgcggtcgacgtcgagctcggcaagcaggtgcccgccacccgccaccgggagcgggtg
gcggagtcgctcgccggccagggggcggtcgcgctcgtcgcggacgtcgacgcgggtctc
gcggtggcggacggctgggccgccgagcatctggagatccacaccgcggacgccgccgcg
gtcgccgcccgggtgcgccacgccggagcggtcttcgtcggcgactacgctcccgtcccg
ctcggcgactacctggccgggtccaaccacgtcctgcccaccggcggcaccgcccggcat
tccagcggtctggcggtcaccgccttccaacgtcaggtccaggtggtcgagtgcacgcgg
gaggggctcgccgccgtcgccccgcgtatcgccgcgctcggcggggcggaggacctcaca
gctcacgtcgacgcggtggaggttcgactccgatga

DBGET integrated database retrieval system