KEGG   Frankia sp. CcI3: Francci3_3089Help
Entry
Francci3_3089     CDS       T00320                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
fra  Frankia sp. CcI3
Brite
Enzymes [BR:fra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Francci3_3089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
3660736..3661533
Genome map
AA seq 265 aa AA seqDB search
MAGVTGAAVLPGAEPFEFEGGSVGVLLVHGFTGSPGSMRPWGEYLSAVGLTVSCPLLPGH
GTRWQDMVPTTWPDWYATAETAFLRLRTTCEQVFVMGLSMGGTLALRLAEQHGGDLAGLV
TVNPSLTTDRWHAAFAPLLSRVIPAVPGVAGDVKAEGVPEVGYDRVPLRPFASLRQLWAV
TRPELGRIVCPVLTYRSVVDHVVEASSGAILLAGLRAPAEERLLENSYHVATLDNDRETI
FDGSLEFVRRHAPRALVPDAPCGDD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgtcaccggtgcggccgtcctcccgggcgcggaaccgttcgagttcgagggt
gggtcggtcggcgtgctgctggtccacgggttcaccggctccccgggcagcatgcggccc
tggggcgagtacctctccgcagtcggactgacagtctcgtgcccgctgctgcccggccat
ggcacccgctggcaggacatggtgcccactacctggccggactggtacgctacggcggag
accgcgtttctgcggctgcggaccacctgcgagcaggtcttcgtcatggggctgtcgatg
ggcgggaccctggccctgcggctggccgagcagcacggcggggacctcgccggcctcgtc
acggtgaatcccagcctcaccaccgaccggtggcacgcggcgttcgccccgctgctgagc
cgggtgatccccgccgtgcctggcgtggctggcgacgtgaaggccgagggcgtgcccgag
gtcggttacgaccgggtacccctgcgcccgttcgcgtcgctgcgccaactgtgggcggtg
acccggccggagctcggtcggatcgtctgtccggtcctcacctaccgcagcgtcgtcgac
catgtggtggaagccagctccggcgcgattctgctggccgggctgcgcgccccggccgaa
gaacgactgttggagaacagttaccacgtcgcgacgctcgacaacgaccgagaaacgatc
ttcgacggaagtctggaattcgtccggcggcacgcgccacgcgcgctcgtgcccgacgcg
ccctgcggcgatgactga

DBGET integrated database retrieval system