KEGG   Frankia sp. CcI3: Francci3_3135Help
Entry
Francci3_3135     CDS       T00320                                 

Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fra  Frankia sp. CcI3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_3135
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Francci3_3135
  Amino acid metabolism
   00310 Lysine degradation
    Francci3_3135
Enzymes [BR:fra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Francci3_3135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
3707484..3708947
Genome map
AA seq 487 aa AA seqDB search
MSVSVTMPRLGESVSEGTVTRWLKQEGERVEADEPLLEVSTDKVDTEIPAPASGVVSSIK
VAEDETVEVGVELAVIDDGSAGGGTAPAQATQAPAAPEPEPEPAPEPVKPAAAAPPPPPT
PTPAPAPTPAPAPTPAPAPTPAPAPAFARQPELTPVPAQTPAAANGNGGGIGRYVTPLVR
KMAAELGVDLGTVAGTGPGGRVTKQDIQDAARPRDAAPAAQETPATPPTAPTAPAVAPTV
APTGAAPVRGQTEKLSRLRALVARRMVESLQISAQLTTVVEADVTRIARLRDRAKSGFQA
REGIKLSFLPFFALATCAALREFPQLNSSIDVEAGTVTYHGEENLGIAVDSERGLVVPVI
HNAGDLNLIGLARKIDDLASRTRANRISPDELGGGTFTLTNTGSRGALFDTPIINQPQVG
ILGTGIVTKKPAVVDDPELGEIIAVRSTVYLSLTYDHRIVDGADAARFLAFTKHRLENGA
FEAELGL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtatctgtcacaatgccccggctcggggagagtgtctccgagggaaccgtcacg
cggtggctgaagcaggagggtgaacgcgtcgaggccgacgagccactgctcgaagtcagc
accgacaaggtcgacaccgagatccccgcccccgcctccggtgtcgtcagctcgatcaag
gtcgccgaggatgagaccgtcgaggtcggcgtcgagctcgcggtgatcgacgacgggtcc
gcgggtggcggcaccgcaccggcgcaggccacgcaggcgcccgccgcgccggagccggaa
cccgaaccggcgccggaacccgtgaagccggctgccgcggcaccgccgcctccgcccact
ccgacgcccgcacccgcgccgacgcccgcacccgcgccgacgcccgcacccgcgccgacg
cccgcgccggcaccggcgttcgctcgtcagccggagctcaccccggtcccggcccagacc
ccggccgccgccaacgggaacggcggcggcatcggtcgctacgtcaccccgctggtgcgc
aagatggccgccgagctcggcgtggacctgggaaccgtggcgggaaccgggccgggtgga
cgcgtcaccaagcaggacatccaggacgccgcgcggccgcgggacgcggctcccgcggcg
caggagactcccgcgaccccccccacagccccgacagccccagccgtggcgccgaccgtg
gcgccgaccggcgctgcccccgtccgcggccagaccgagaagctctcccgcctgcgggcg
ttggtcgctcgccgcatggtcgagtcgctgcagatcagcgcgcagctcaccaccgtggtg
gaggccgacgtcacccggatcgcgcggctgcgggaccgggcgaagagcggcttccaggct
cgggagggcatcaagctgtcattcctgccgttcttcgccttggcgacctgtgcggcgctg
cgtgagttcccgcagctcaactccagcatcgacgtcgaggcgggcacggtcacctaccac
ggagaggagaacctcggcatcgccgtggactccgagcgtggtctggtcgtgcccgtcatc
cacaacgccggcgatctcaacctcatcgggctggcccgcaagatcgacgacctggcgagc
cgcacccgggccaaccgaatctcgcccgacgagctcggcggcggcaccttcaccctgacg
aacaccggcagtcgaggcgccctgttcgacacgccgatcatcaaccagccgcaggtgggc
atcctcggcaccggcatcgtgacgaagaagccggccgtcgtcgacgatccggagctgggc
gagatcatcgcggttcgttcgacggtgtacctgtccctcacctacgaccaccgcatcgtc
gacggtgccgacgcggctcgcttcctggccttcaccaagcaccggctggaaaacggagcc
ttcgaagccgaactcggcctgtag

DBGET integrated database retrieval system