KEGG   Frankia sp. CcI3: Francci3_3185Help
Entry
Francci3_3185     CDS       T00320                                 

Definition
(GenBank) 6,7-dimethyl-8-ribityllumazine synthase (EC:2.5.1.9)
  KO
K00794  
6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
fra  Frankia sp. CcI3
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Francci3_3185
Enzymes [BR:fra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     Francci3_3185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3774556..3775038)
Genome map
AA seq 160 aa AA seqDB search
MSGLGAPAEVLPPVAGMRLAVVATRWHAEITDALLAGALRAAKDAGLAAAPAVVRVSGAV
ELPVIAAALAARHDAVVALGVVIRGGTPHFDYVCQFVTAGLARVTLDARVPVGFGVLTCD
TVEQARDRAGLPGSSEDKGREATLAALDTAAVLRDLELAG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcctcggggctcccgcggaggtgcttccgcccgtcgcgggcatgcggttggcg
gtggtcgccacccggtggcacgccgagatcaccgatgcgctgctcgctggcgcgctgcgc
gccgcgaaggacgcgggcctcgcggcggcacccgccgtcgtgcgggtctccggtgcggtc
gagcttcccgtgatcgccgccgcgttggctgcgcggcatgacgccgtcgtcgccctcggt
gtcgtcatccggggcggcaccccccacttcgactacgtctgtcagttcgtcaccgcgggg
ctcgcccgcgtcaccctcgacgcccgcgtccccgtcggcttcggcgtgctcacctgcgac
accgtcgagcaggcccgggaccgcgccgggctgcccgggtccagcgaggacaagggccgg
gaggcgaccctggccgcgctggacaccgccgcggtgctgcgcgatctggaactcgccggc
tga

DBGET integrated database retrieval system