KEGG   Frankia sp. CcI3: Francci3_3195Help
Entry
Francci3_3195     CDS       T00320                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fra  Frankia sp. CcI3
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fra00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3786594..3787148)
Genome map
AA seq 184 aa AA seqDB search
MVPMGLTVLSGPSGVGKDTVVAAVRERHPEVWVSVSATTRPPRPGETDGVEYHFVDAEEF
ARMVKAGEFVEHAMFAGHAYGTPRRPLLERLAAGVPCLLEIELLGARQVRSAMPQARFVF
LAPPTFDELVRRLTGRGTESPEVIARRLDRARIELAAETEFDDVIVNDDVRSAAARLVAL
MIGS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcccatgggtcttacagtgctgtccgggccgtccggagtcgggaaggacaccgtc
gtcgcggcagtccgggaacgtcaccccgaggtctgggtctcggtcagcgccaccacgcgg
ccaccgcgtccgggtgagactgacggtgtcgagtaccacttcgtcgacgccgaggagttc
gcccggatggtcaaggccggggagttcgtcgagcacgcgatgtttgccggacacgcctac
ggcaccccccgccgtccgcttctcgaaaggctcgccgcgggtgtgccctgcctgctggag
atcgagctgctgggcgcccggcaggtgcgctcggcgatgccacaggcccgtttcgtcttc
ctcgccccgcccaccttcgacgagctcgtccgtcggctgaccggtcgggggaccgagtca
cccgaggtcatcgcccgcaggctggaccgggcgcgcatcgaactcgcggccgagacggag
ttcgacgacgtgatcgtgaacgacgacgtgcggtccgcggcagcccgcttggtagcattg
atgatcggctcgtag

DBGET integrated database retrieval system