KEGG   Frankia sp. CcI3: Francci3_3316Help
Entry
Francci3_3316     CDS       T00320                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fra  Frankia sp. CcI3
Brite
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Francci3_3316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Ubie_methyltran Methyltransf_11 Methyltransf_3 RrnaAD Methyltransf_12 Methyltr_RsmB-F CMAS Spermine_synth
Motif
Other DBs
NCBI-ProteinID: ABD12673
JGI: Francci33316
RhizoBase: Francci3_3316
UniProt: Q2J7R9
Position
complement(3930523..3931818)
Genome map
AA seq 431 aa AA seqDB search
MTDVSSPVEPNSDVSGLDRAAQLRRKMVDDLLAEGTITSRPVEAAMRKVRREAFAPGVEL
EEAYQLYNGVVTKRDDAGSSVSSVSAPQVQAYMLEQAAITPGMRILEIGSGGYNAALIAE
LVGPAGQVTTVDIDKDVIDRARHLLAQVGYPQVNVVLADAEFGVPEHAPYDRILVTVGAW
DVPPAWVAQLAEGGRLAVPLQLRGLSRVITFERANEYLLSRASRLFGFVPIQGAGAHQTT
LLVLREGEITLRFEEGPPTDPGLLEGVFDAPRVEVWSGVTIGRFEPWAGTQMWLATVLPG
FCRVVLDRKLDTGLLSPPGSHSAAVAVVDDDTLAYVTTRGAADSVDVELGVHAFGPGASE
LAEQVAEQLQVWGREHRHSSPQFRVDPAGTADDQLPAGRVIDKKHSRITISWPGAASVAA
GRGAASRRAGG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgtgtcttcacccgtagagccgaacagcgacgtctccggcctcgatcgcgca
gcgcagctgcgcaggaagatggttgacgatcttcttgccgagggcacgatcacctcgcgg
ccggtcgaggccgcgatgcgcaaggtccgtcgggaagccttcgcaccgggggtggagctg
gaggaggcttaccagctttacaacggagtagttacgaagcgcgacgacgctggaagttct
gtgagctcggtttccgctccgcaggtccaggcgtacatgctggagcaggctgcgatcacc
cccggcatgaggatcttggagatcggctctggggggtacaacgctgccttgatcgccgag
ctcgtcggtccggcaggtcaggtcaccacggtcgacatcgacaaggacgtcatcgaccgg
gcgcgccatcttctcgcgcaggtcggctaccctcaggtgaacgttgtgctcgccgacgcc
gagttcggtgtgcctgagcacgccccttatgaccgtattttggtcacggtcggtgcgtgg
gacgttccgccggcttgggtggctcagctggccgagggcggtcgtctggcggtgccgttg
cagctgcggggcctgtcgcgtgtgatcaccttcgagcgagccaacgagtacttgctcagt
cgggcgtcccggttgttcggcttcgtgcctatccagggcgccggagcgcaccagaccacg
ttgctggtcctacgcgagggtgagatcaccttgcgcttcgaggaggggcccccgaccgat
ccgggcctgctggaaggcgtattcgacgcgccgcgggtggaggtctggagcggggtcacg
atcggccgtttcgaaccgtgggccggtacgcagatgtggctcgccaccgtgctgccgggc
ttctgtcgcgttgtgctggacagaaagctggacacgggtctgctctccccaccgggcagt
cactccgccgcggtggccgtcgtcgacgacgacaccctcgcctatgtcacgacgcgcggt
gcggcggactcggtggacgtcgagttaggtgtgcatgccttcggtccgggcgcgtccgag
ctggccgaacaggtcgccgagcagctccaggtctgggggcgggaacaccgccacagctcg
ccacagttccgcgttgaccccgcaggcaccgccgatgaccagctgccggctggccgcgtc
atcgacaagaagcacagccggatcacgatctcctggccgggagcggcgagcgtcgcggcc
ggccggggcgcagcatcccgccgagcaggaggatga

DBGET integrated database retrieval system