KEGG   Frankia sp. CcI3: Francci3_3316Help
Entry
Francci3_3316     CDS       T00320                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fra  Frankia sp. CcI3
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(3930523..3931818)
Genome map
AA seq 431 aa AA seqDB search
MTDVSSPVEPNSDVSGLDRAAQLRRKMVDDLLAEGTITSRPVEAAMRKVRREAFAPGVEL
EEAYQLYNGVVTKRDDAGSSVSSVSAPQVQAYMLEQAAITPGMRILEIGSGGYNAALIAE
LVGPAGQVTTVDIDKDVIDRARHLLAQVGYPQVNVVLADAEFGVPEHAPYDRILVTVGAW
DVPPAWVAQLAEGGRLAVPLQLRGLSRVITFERANEYLLSRASRLFGFVPIQGAGAHQTT
LLVLREGEITLRFEEGPPTDPGLLEGVFDAPRVEVWSGVTIGRFEPWAGTQMWLATVLPG
FCRVVLDRKLDTGLLSPPGSHSAAVAVVDDDTLAYVTTRGAADSVDVELGVHAFGPGASE
LAEQVAEQLQVWGREHRHSSPQFRVDPAGTADDQLPAGRVIDKKHSRITISWPGAASVAA
GRGAASRRAGG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgtgtcttcacccgtagagccgaacagcgacgtctccggcctcgatcgcgca
gcgcagctgcgcaggaagatggttgacgatcttcttgccgagggcacgatcacctcgcgg
ccggtcgaggccgcgatgcgcaaggtccgtcgggaagccttcgcaccgggggtggagctg
gaggaggcttaccagctttacaacggagtagttacgaagcgcgacgacgctggaagttct
gtgagctcggtttccgctccgcaggtccaggcgtacatgctggagcaggctgcgatcacc
cccggcatgaggatcttggagatcggctctggggggtacaacgctgccttgatcgccgag
ctcgtcggtccggcaggtcaggtcaccacggtcgacatcgacaaggacgtcatcgaccgg
gcgcgccatcttctcgcgcaggtcggctaccctcaggtgaacgttgtgctcgccgacgcc
gagttcggtgtgcctgagcacgccccttatgaccgtattttggtcacggtcggtgcgtgg
gacgttccgccggcttgggtggctcagctggccgagggcggtcgtctggcggtgccgttg
cagctgcggggcctgtcgcgtgtgatcaccttcgagcgagccaacgagtacttgctcagt
cgggcgtcccggttgttcggcttcgtgcctatccagggcgccggagcgcaccagaccacg
ttgctggtcctacgcgagggtgagatcaccttgcgcttcgaggaggggcccccgaccgat
ccgggcctgctggaaggcgtattcgacgcgccgcgggtggaggtctggagcggggtcacg
atcggccgtttcgaaccgtgggccggtacgcagatgtggctcgccaccgtgctgccgggc
ttctgtcgcgttgtgctggacagaaagctggacacgggtctgctctccccaccgggcagt
cactccgccgcggtggccgtcgtcgacgacgacaccctcgcctatgtcacgacgcgcggt
gcggcggactcggtggacgtcgagttaggtgtgcatgccttcggtccgggcgcgtccgag
ctggccgaacaggtcgccgagcagctccaggtctgggggcgggaacaccgccacagctcg
ccacagttccgcgttgaccccgcaggcaccgccgatgaccagctgccggctggccgcgtc
atcgacaagaagcacagccggatcacgatctcctggccgggagcggcgagcgtcgcggcc
ggccggggcgcagcatcccgccgagcaggaggatga

DBGET integrated database retrieval system