KEGG   Frankia sp. CcI3: Francci3_3492Help
Entry
Francci3_3492     CDS       T00320                                 

Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_3492
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_3492
   00520 Amino sugar and nucleotide sugar metabolism
    Francci3_3492
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Francci3_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4163389..4164225
Genome map
AA seq 278 aa AA seqDB search
MQVFGVDVGGSGIKGAPVNVEDGSLAAPRFRLATPQPAEPTAVAATVAEVVGRFGWSGPV
GATLPAVVKNGVALTAANIAPSWIGTDVVSLFAEALGGSAAATGPVDITVMNDADAAGIA
EMTFGAGRDTTGLVVVTTFGTGIGTALFLHGQLVPNTELGHLEISGHDAETRASDAARER
EGLSWEKWAKRVTRYLNTIEALLWPDLIIIGGGVSKRADKYLDQLEVRTRVIPAQLQNEA
GIVGAAISGLVDQNRPRPAARPARRRGPATRPPGGRRP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcttcggggttgacgtcggcggaagcggaatcaagggcgctccggtcaacgtc
gaggacgggtcgctggccgcgcccaggttccggctggcgactccgcagccggccgagccc
accgcggtggccgcgaccgtggcggaggtggttggccgcttcggctggtcgggaccggtg
ggagccaccctgcccgcagtggtcaagaacggggtggcgctcacggcggcgaacatcgcc
ccgtcctggatcggcaccgacgtggtgtccctgttcgccgaggcgctgggcgggtcggcc
gccgccacgggcccggtggacatcaccgtgatgaacgacgcggacgcggcgggcatcgcc
gagatgaccttcggcgccggacgcgacaccaccggcctggtcgtcgtgacgacgttcgga
accgggatcggtaccgcgctgttcctccacggccagctcgtgcccaacaccgaactcggc
cacttggagatctccgggcacgacgcggagaccagggcgtccgatgcggcccgggaacgc
gagggcctctcctgggagaagtgggccaaacgggtgaccaggtacctcaacaccatcgag
gcgctgctctggcccgacctcatcatcatcggtggtggggtgagcaagagagcggacaaa
tacctcgaccagctcgaggtgcgtacccgagtgatccccgcgcaactccagaacgaggca
ggcatcgtcggcgccgccatctccggcctggtcgaccagaaccggccccgaccggctgcc
cggcccgcccgccgccgaggtcccgcgacccgccccccgggcggcaggcgaccataa

DBGET integrated database retrieval system