KEGG   Frankia sp. CcI3: Francci3_3492Help
Entry
Francci3_3492     CDS       T00320                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
fra  Frankia sp. CcI3
Pathway
fra00010  Glycolysis / Gluconeogenesis
fra00520  Amino sugar and nucleotide sugar metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01130  Biosynthesis of antibiotics
fra01200  Carbon metabolism
Module
fra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_3492
   00520 Amino sugar and nucleotide sugar metabolism
    Francci3_3492
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Francci3_3492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABD12845
JGI: Francci33492
RhizoBase: Francci3_3492
UniProt: Q2J797
Position
4163389..4164225
Genome map
AA seq 278 aa AA seqDB search
MQVFGVDVGGSGIKGAPVNVEDGSLAAPRFRLATPQPAEPTAVAATVAEVVGRFGWSGPV
GATLPAVVKNGVALTAANIAPSWIGTDVVSLFAEALGGSAAATGPVDITVMNDADAAGIA
EMTFGAGRDTTGLVVVTTFGTGIGTALFLHGQLVPNTELGHLEISGHDAETRASDAARER
EGLSWEKWAKRVTRYLNTIEALLWPDLIIIGGGVSKRADKYLDQLEVRTRVIPAQLQNEA
GIVGAAISGLVDQNRPRPAARPARRRGPATRPPGGRRP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcttcggggttgacgtcggcggaagcggaatcaagggcgctccggtcaacgtc
gaggacgggtcgctggccgcgcccaggttccggctggcgactccgcagccggccgagccc
accgcggtggccgcgaccgtggcggaggtggttggccgcttcggctggtcgggaccggtg
ggagccaccctgcccgcagtggtcaagaacggggtggcgctcacggcggcgaacatcgcc
ccgtcctggatcggcaccgacgtggtgtccctgttcgccgaggcgctgggcgggtcggcc
gccgccacgggcccggtggacatcaccgtgatgaacgacgcggacgcggcgggcatcgcc
gagatgaccttcggcgccggacgcgacaccaccggcctggtcgtcgtgacgacgttcgga
accgggatcggtaccgcgctgttcctccacggccagctcgtgcccaacaccgaactcggc
cacttggagatctccgggcacgacgcggagaccagggcgtccgatgcggcccgggaacgc
gagggcctctcctgggagaagtgggccaaacgggtgaccaggtacctcaacaccatcgag
gcgctgctctggcccgacctcatcatcatcggtggtggggtgagcaagagagcggacaaa
tacctcgaccagctcgaggtgcgtacccgagtgatccccgcgcaactccagaacgaggca
ggcatcgtcggcgccgccatctccggcctggtcgaccagaaccggccccgaccggctgcc
cggcccgcccgccgccgaggtcccgcgacccgccccccgggcggcaggcgaccataa

DBGET integrated database retrieval system