KEGG   Frankia sp. CcI3: Francci3_3573Help
Entry
Francci3_3573     CDS       T00320                                 

Definition
(GenBank) 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (EC:1.17.7.1)
  KO
K03526  
(E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3]
Organism
fra  Frankia sp. CcI3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Francci3_3573
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.7  With an iron-sulfur protein as acceptor
    1.17.7.1  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (ferredoxin)
     Francci3_3573
    1.17.7.3  (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin)
     Francci3_3573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4270849..4272003)
Genome map
AA seq 384 aa AA seqDB search
MTVTLGMPTAPARPLGTRRHSRQIHVGNVLVGGDAPVSVQSMCTTLTSDVNATLQQIAQL
TASGCQIVRVAVPSQDDADALAAIARKSPIPVIADIHFQPKYVFAAIDAGCAAVRVNPGN
IKAFDDKVGEIARAAKAAGVPIRIGVNAGSLDKRLLAKYGKATPEALTESALWECSLFEE
HDFRDIKISVKHHDPVVMIQAYRLLAQACDYPLHLGVTEAGPSFQGTVKSAVAFGALLAE
GIGDTIRVSLSAPPVEEVKVGTAILESLGLRQRKLEIVSCPSCGRAQVDVYTLANQVSAG
LEGMEVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVVKTVPEAQIVETLIE
EAMRLAEEMAADGTPSGEPSVSVG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtaactctgggcatgccaaccgctccggcccgtccgctcggcacgcggcggcac
agccggcagatccacgtgggcaacgtcctggtcgggggtgacgctccggtctccgttcag
tcgatgtgcaccacgttgacgtcggacgtcaacgccacgctgcagcagatcgcacagctg
acagcgtcgggatgccagatcgtccgggtcgcggtgccaagccaggacgacgccgacgcc
ctcgccgcgatcgcccgcaagtccccgatcccggtgattgccgatatccacttccagccc
aagtacgtcttcgccgcgatcgacgcgggctgcgccgcggtccgggtcaaccccggcaac
atcaaggcttttgacgacaaggtcggggagattgctcgcgcggcgaaggccgccggcgtt
ccgatccggatcggggtcaacgcgggttcactcgacaagcggctgttggcgaagtacggc
aaggccacgccggaggcgctgacggagtcggccttgtgggaatgctcgctgttcgaggag
cacgacttccgtgacatcaagatctcggtgaagcaccacgacccggtcgtcatgatccag
gcgtaccggctgctcgcccaggcctgcgactacccgctgcacctcggtgtcaccgaggcc
ggaccgtccttccagggcacggtcaagtccgcggtcgccttcggggccctgctcgccgag
ggaatcggtgacacgatcagggtgtcgctgtcggcaccgccggtcgaggaggtgaaggtc
ggcaccgcgatcctggagtccctgggacttcggcagcgtaagctcgaaatcgtatcctgc
ccttcctgcggtcgggctcaggtcgatgtctacacccttgccaatcaggtcagcgccggt
ctcgagggcatggaggtcccgttgcgcgtcgccgtcatgggctgcgtcgtgaacgggccg
ggcgaggccagggaggccgatctcggcgtcgcatccgggaacggcaagggtcagatcttc
gtccgaggtgaggtcgtgaagaccgttccggaggcgcagatcgtggaaaccctcattgag
gaagccatgcggctggccgaggagatggcggcggacggcaccccgtccggcgaaccctcg
gtttccgtgggttaa

DBGET integrated database retrieval system