KEGG   Frankia sp. CcI3: Francci3_3577Help
Entry
Francci3_3577     CDS       T00320                                 

Definition
(GenBank) 23S rRNA m(2)A-2503 methyltransferase (EC:2.1.1.-)
  KO
K06941  
23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
fra  Frankia sp. CcI3
Brite
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     Francci3_3577
Ribosome biogenesis [BR:fra03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Francci3_3577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4276080..4277345)
Genome map
AA seq 421 aa AA seqDB search
MTATTAESGRPDQPPTAEAGRPVRLTLTRRAGRAPRHLADLTRQERRDVAVSLGQPAFRA
DQVARHYYARLIAADEPEAMTDLPERDRQPLLDALLPRLLVPVRTLSCDDGLTRKTAWRT
VDGASLESVIMRYPDRATVCVSSQAGCGMGCPFCATGQGGLTRNLSTAEIVEQVVHAARV
LRRRELAGGETRLSNVVFMGMGEPLANYAAVIAALRRLTAHPPEGLGLSARGLTVSTVGL
VPAIRRLAGEGLPVTLAVSLHAPDDVLRNELVPINTRWPVVEVLAAAWEYAEVTGRRVSV
EYALIDGVNDDVGRADALADLLVGRLAHVNLIPLNPTGGSSWRASAPAGQRAFVRRLRDR
GIVTTVRDTRGREIAAACGQLAAEPAGKPERTDRPEQVGSDRLVEFGAVGSTTPDGDRVL
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgactgccacgaccgccgaatccggacgtccggaccagcccccgaccgccgaggcgggc
cggcccgtgcggctgacgctcacccggcgagcgggccgagcgccgcgtcacctcgccgac
ctgacccggcaggaacggcgtgacgtcgcggtgtcgctggggcagccggccttccgcgcc
gatcaggtggcccggcactactatgcgcggttgatcgccgccgatgagcccgaggcgatg
accgacctgccggagcgggaccgccagccgctcctcgacgccctgctgccgaggctgctc
gtcccggtgcggacgctgagctgcgacgacggtctgacccgcaagacggcatggcggacc
gtggacggcgcttctctcgagtctgtgatcatgagatatccggatcgcgcgacggtctgt
gtgtcgagccaggcgggctgcggcatgggctgcccgttctgtgccaccggtcaggggggg
ctgacccgaaacctgtcgaccgcggagatcgtcgaacaggtcgtgcacgccgcccgggtt
ctccggcgccgtgagctcgcgggcggcgagaccaggttgtcgaacgtggtcttcatgggg
atgggcgagccgctggcgaactatgccgcggtgatcgccgcgctacgccgcctcaccgct
cacccccccgagggcctgggcctgtcggctcgcggcctgacggtcagcaccgtcggcctt
gttccggcgattcgtcgtctcgccggagagggcctgccggtgactctggcggtgtccctg
cacgccccggacgacgttctgcggaacgaactcgtccccatcaacacccgttggccggtg
gtcgaggtgctcgcggccgcctgggagtacgccgaggtgaccggcagacgggtaagcgtc
gagtacgcgctgatcgacggggtcaacgatgacgtgggacgcgccgacgccctcgcggac
ctgctcgtcggccggctcgcgcatgtgaacctcattccgttgaatccgaccggtggatcc
tcgtggcgcgccagcgccccggccggccagcgcgcgttcgtccgcaggctccgggaccgc
ggcatcgtgacgacggtgcgcgacacccggggccgggagatcgcggcagcctgcggacag
ctcgcggccgagccggccgggaagccggagcggacggaccggccggagcaggtcggatcc
gaccgtctcgtcgagttcggtgccgtggggagcacgacgcctgacggtgaccgtgtcctt
cggtag

DBGET integrated database retrieval system