KEGG   Frankia sp. CcI3: Francci3_3600Help
Entry
Francci3_3600     CDS       T00320                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fra  Frankia sp. CcI3
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:fra00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Francci3_3600
Enzymes [BR:fra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Francci3_3600
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Francci3_3600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4302169..4303140)
Genome map
AA seq 323 aa AA seqDB search
MPELPEVEVVRRGLERGVVGRVIASVDVHHPRAVRRHLAGAADFSALLVGRRITAARRRG
KYLWLVLQPPVDHAACAPVVPEEPPEEESAAVLAEMSPPALPPGHPAQGDALIAHLGMSG
QLLVVPPATPDQKHLRIRFVFTDGGRELRFVDQRTFGGLAVATGEADLPAPVAHIARDPL
DPAFDERLVTERMRRRRTGVKRALLDQTLVSGVGNIYADEALWAAKLHYARPTETLTRAE
VGRLLGCVRTVMIAALEVGGTSFDRLYVSADGVSGLFERSLQVYGRAGRPCTRCGDAVRR
DAFMNRSSFTCPTCQPHPRRARW
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccagaactccccgaagtagaggttgttcgccgcggtctggaacgtggtgtcgtcggt
cgcgtcatcgcatcggttgacgtccaccatcctcgtgcggtgcgccgtcatctggccggt
gccgccgacttctcggcgctgctcgtcggccgccggataacggcggcacgacgccgcggc
aagtatctgtggctggtacttcagccgccggtagaccatgcggcgtgcgctccggtggtt
ccagaagaaccaccggaggaggaatcagctgccgtgctggccgagatgtctccgcccgcc
ctgcccccaggtcatccggctcagggggatgcactgatcgcccatctcgggatgagcgga
cagttgctcgtcgttccacccgccacccccgaccagaagcatctgcggatccggttcgtc
ttcacggacggaggacgcgaactgcgatttgtggatcaacgcaccttcggtggcctggcg
gtcgcaacgggggaagcggatctgcctgctcccgtcgcgcacatcgccagggatcctctg
gatcccgccttcgacgagcggctcgtcacggagaggatgcgtcgacgccgtaccggcgtg
aagcgggccctgctcgatcagacacttgtcagcggggtcgggaacatctacgcggatgag
gccctgtgggccgcgaagctgcactacgcgcggccgaccgagaccctcacccgggcggag
gtcggcaggctgctgggttgcgtgcggacggtgatgatcgcggctcttgaggtgggcggt
acgtccttcgaccgcctgtacgtgtcggcggacggagtcagcgggctgttcgaacggtcg
ctacaggtgtatggccgcgcgggtcggccgtgcacacgatgcggagacgcggtgcgccgg
gacgctttcatgaaccggtcgagcttcacttgccccacctgccagccgcacccaagacgg
gccaggtggtaa

DBGET integrated database retrieval system