KEGG   Frankia sp. CcI3: Francci3_3681Help
Entry
Francci3_3681     CDS       T00320                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fra  Frankia sp. CcI3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Francci3_3681
Enzymes [BR:fra01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Francci3_3681
Exosome [BR:fra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Francci3_3681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4416474..4418912
Genome map
AA seq 812 aa AA seqDB search
MNNGDVNNGTARTGRLATGLAPDRPNPRGAATAVRNGGGRVALADRDASSASAQPGQTAD
DPAVPSAPPSAPPSALPADPPAVAPAVSVDLPYDDLERLVSGAHHDPHALLGAHPHPGSD
ATVVRVLRPDARAVTVLVGPARYPATRLHSGGVFGVAVPGMLPDYRIEVTYPDGPYLIDD
PYRHLPTLGEMDLHLIIEGRHEQLWKVLGAHPRALTTPGGATVTGVSFAVWAPSARGVRL
VGDFDFWDGRAFPMRSLGRSGIWELFVPGAGTGARYKYEILGFDGIWRQKADPLAFHTEV
PPATASVVFASDFTWNDGAWLDRRARTAWRTEPVSVYEVHLGSWRRGLSYRELAEELTAY
VVENGFTHVEMLPVAEHPFGGSWGYQVSAYYAPTARFGSPDEFRHLVDTLHRAGIGVIVD
WVPAHFPRDTWALGRFDGTPLYEHPDPRRGEQPDWGTYVFDLGRPEVRNFLVANALYWFE
EFHIDGLRVDAVASMLYLDYSRPEGGWLPNIHGGRENLDAVSFLQETNATVYRRFPGAMM
IAEESTAWPGVTRPTHLGGLGFGFKWNMGWMHDTLDYNSRLPIHRMYHHHQMTFSMVYAY
SENFILPFSHDEVVHGKGSLLRKMPGDRWAQLANLRALLAYMWAHPGKKLLFMGCEFAQD
NEWNESASLEWPLLDDPAHAGVADLVRDLNGLYRTVPALYQHDADPAGFSWIDANDAENN
VFSFLRWSGEDPAGGVLACVTNFAGIGHEGYRIGLPFPGRWREILNTDGYRYGGGNIGNL
GSVQAVEEPHHGLDASATLTLPPLGAIWLSPA
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacggcgacgtcaacaacggcacggcgcggacgggacgcctggccaccgggctc
gcccccgaccgaccgaacccccgaggggcggccaccgccgtccgcaacggcggtggccgg
gtggcgctggcggaccgcgacgcatcgtccgccagcgcccagcctggacagaccgccgac
gatcccgccgtgccatcggccccaccatcggccccaccatcggccctgcccgcagacccg
cccgcggttgcgcccgcggtctcggtcgacctgccctacgacgacctggagcggttggtc
agcggggcgcatcacgacccgcacgcgctgctcggggcgcacccgcatcccgggagcgac
gccacggtcgtccgggtgctgcgccccgatgcgagggccgtgaccgtcctcgtcgggccg
gcccgctacccggccacccggctgcacagcggcggggtgttcggagtggccgtgccggga
atgctgcccgactaccgcatcgaggtgacctacccggacggcccgtacctcatcgacgac
ccctaccggcacctgcccaccctcggtgagatggacctccatctgatcatcgagggccgg
cacgaacagctctggaaggtgctcggggcgcatccgcgcgcgctgacgacgccgggcggc
gccacagtcaccggggtcagcttcgccgtgtgggccccctccgcgcggggagtgcggctc
gtcggcgatttcgacttctgggacgggcgtgccttcccgatgcgctcgctcggccgctcc
gggatctgggagctgttcgtccccggcgccggcaccggcgcccggtacaagtacgagatc
ctcggcttcgacgggatctggcggcagaaggcggatccgctggcgttccacaccgaggtg
ccgccggccaccgcgagcgtggtgttcgcctccgacttcacctggaacgacggcgcgtgg
ctcgaccggcgggcccggacggcctggcgcaccgagccggtgagcgtctacgaggtccac
ctgggctcctggcggcgcgggttgtcctatcgggagctcgctgaggaactgaccgcgtac
gtcgtcgagaacggcttcacccacgtggagatgctgcccgtggccgagcatcccttcggc
ggctcctggggctaccaggtgtcggcctactacgccccgacggcccgcttcggcagcccc
gacgagttccgccaccttgtggacacgctgcaccgcgccggcatcggggtgatcgtcgac
tgggtgccggcgcacttcccccgggacacctgggcgctgggccgcttcgacggcaccccc
ctgtacgaacatcccgatccacgccgcggtgaacagcccgactggggtacctacgtcttc
gatctgggccgccccgaggtacgcaacttcctcgtggcaaacgccctgtactggttcgag
gaattccacatcgacgggctacgcgtcgacgcggtcgcctcgatgctgtacctcgactac
tcccggccggagggcggctggctgcccaacatccacggcggccgggaaaacctcgacgcc
gtctcgttcctgcaggagaccaacgccaccgtctaccgccgtttcccgggcgcaatgatg
atcgcggaggagtcgaccgcgtggcccggggtcacccgccccacccacctcggcggcctg
ggcttcggcttcaaatggaacatggggtggatgcacgacaccctcgactacaactcccgg
ctgccgatccaccgcatgtaccaccaccatcagatgaccttttcgatggtgtacgcctac
tcggagaacttcatcctgccgttcagccacgacgaggtggtccacggcaaaggttcactg
ctacgcaagatgcccggcgaccgctgggcacagctcgcgaacctgcgggcgctgctcgcc
tacatgtgggcgcatcccggcaagaagctgctcttcatgggctgcgagttcgcccaggac
aacgagtggaacgagtccgcgtccctcgaatggcccctgctggacgatcccgcccacgcc
ggtgtcgcggacctcgtgcgcgacctgaacggtctctaccggacggtcccggccctgtac
caacacgacgccgacccggcgggcttctcctggatcgacgcgaacgacgcggagaacaac
gtcttctcgttcctgcggtggtcgggcgaggacccggcgggcggcgtgctggcctgcgtc
accaacttcgccggcatcgggcacgagggctaccgcatcgggctgccgttccccggccgc
tggcgcgagatactcaacaccgacgggtaccgctacggcggcggcaacatcggcaatctc
ggctcggtccaggctgtcgaggagccgcatcacggtctcgacgcctcagcaaccctgacg
ctgccgcctctcggggccatctggctctcccccgcctag

DBGET integrated database retrieval system