KEGG   Frankia sp. CcI3: Francci3_3724Help
Entry
Francci3_3724     CDS       T00320                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fra  Frankia sp. CcI3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Francci3_3724
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Francci3_3724
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Francci3_3724
Enzymes [BR:fra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Francci3_3724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4458413..4459546)
Genome map
AA seq 377 aa AA seqDB search
MTTTSSTPLADEPAVPVLSAAPDRPHRPWQGIIEEYRDRLPIAHDTPVITLREGGTPLLP
AAHLSDLTECEVHLKIEGANPTGSFKDRGMTVAISRAVGAGSQAVICASTGNTSASAAAY
AARAGITCAVLVPSGKIALGKLAQALVHGARLLQLDGSFDDCLRVARELADTSPVTLVNS
VNPFRLEGQKTASFEIVEALGRAPDVHCLPVGNAGNITAYWRGYLEENNRIASGRPRMCG
FQAAGAAPIVRGEVVTSPQTIATAIRIGNPASWDLAVEAREASGGLIDAVNDREILAAYR
LLARREGVFVEPSSAASVAGLLKARAAGRIEPGEQVVCTVTGNGLKDPDWAISGAARPET
IRPTVAGAAEALGLQRS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgacgtcatccacaccgctcgcggacgagccggccgtgccggtgctgtccgcg
gcgcccgatcggccgcaccggccgtggcagggaatcatcgaggagtaccgggaccgtctg
ccgatcgcacacgacacgcccgtcatcacgttgcgtgagggtgggacgcccctgctgccc
gcggcacacctctccgacctcaccgaatgtgaggttcatctcaaaatcgaaggggcgaat
ccgactggctccttcaaggaccgcgggatgacggtggccatcagccgggctgtcggcgcc
ggttcccaggctgtcatctgcgcgtccaccggcaacacctcggcgtcggccgccgcctac
gcggcccgcgccggcatcacctgcgcggtgctggtgcccagcggaaaaattgccctgggc
aagctcgcccaggcgcttgtccacggggcccggctgctgcagctcgacggctccttcgac
gactgcctgcgggtggcgcgcgaactcgccgacacctcgccggtgaccctggtcaactcg
gtgaaccccttccgtctcgaggggcagaagacggcgtccttcgagatcgtggaggcgctc
ggccgggccccggacgtccactgcctgccggtcggcaacgccggcaacatcaccgcttac
tggcggggctacctcgaggagaacaaccggatcgccagcggccgcccgcggatgtgcggt
ttccaggcagcgggtgccgcgcccatcgtgcggggcgaggtggtgacctcgccgcagacg
atcgccacggcgatccgcatcggcaacccggcgtcgtgggatctcgctgtcgaggcgaga
gaggcctccggtggtctgatcgacgccgtgaacgaccgggagatcctcgccgcctaccgc
ctgctggcccgcagggagggcgtcttcgtggagccttccagcgccgccagcgtcgcgggc
ctgctgaaggcacgggcggccggccggattgaacccggcgagcaggtcgtgtgcaccgtc
acgggcaacgggctcaaggaccccgactgggcgatcagcggcgcggcccggccggaaacg
atccgcccgaccgtcgcgggcgccgccgaggcgctggggctgcagcgctcgtga

DBGET integrated database retrieval system