KEGG   Frankia sp. CcI3: Francci3_3821Help
Entry
Francci3_3821     CDS       T00320                                 

Definition
cytochrome-c oxidase (EC:1.9.3.1)
Orthology
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
fra  Frankia sp. CcI3
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase, prokaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:fra00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4580534..4582363
Genome map
AA seq 609 aa AA seqDB search
MTILHQPREPGGAADTGTQPADIVAAHTRPRTPLLGYLRTTSHKDIAILYAVTSFGFFLF
AGVLAIMMRAELARPGLQYFSNEQYNQFFTMHGTLMLLMFATPLAFAFANFLVPLQIGAP
DVAFPRLNALSYWFFLFGSLTVIFGFLTPNGAASFGWFAYSPLNSKVYSPGAGSDLWIVG
LAVSGVGTILGAVNMITTILTMRAPGMTMFRLPIFCWTFLATSILVLIAFPVLAAALLAL
EADRRFGAHVFDAANGGALLWQHLFWYFGHPEVYIIALPFFGVISEILPVFSRKPLFGYK
GLVFATIGIAALSVVVWAHHMFVTGAVLLPFFALMSFLIAVPTGIKFFNWIGTMWRGQLT
FETPMLFAIGFLVTFLFGGLTGVLLASPPIDFHVSDSYFVVAHFHYVVFGTVVFAAYGGT
YFWFPKVTGRLMNDRLGKIHFWTVFLGFHTTFLVQHWLGVQGMPRRYADYGPNDGFTTLN
TISSAGSFLLALSTLPFIYNLWHSYRKGPLAVVDDPWGYGNSLEWATSCPPPRHNFRTLP
RIRSERPAFDLHYPQAAGRIDYHATPEITLTPETTPRPETADPAESTAAESTAAGPDRPA
PESGFRTPE
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattctacaccaaccgagagaaccgggcggagcggcggataccgggacgcagcca
gcggatatcgtcgccgcgcacaccaggccacgtacccctttgctcggctatctgcggacg
acgtcccacaaggacatcgccatcctgtacgccgtcacgtcgttcgggttcttcctcttc
gccggtgtcctggccatcatgatgcgggcggaactcgcccgcccggggctgcagtacttc
tccaacgagcagtacaaccagtttttcacgatgcacggcacgctgatgctgctcatgttc
gcgaccccgctggcgttcgcgttcgcgaacttcctcgtgccgctgcagatcggcgcgccg
gacgtggcgttcccgcggctgaacgcgctgtcctactggttcttcctgttcggcagcctg
acggtgatctttgggttcctgaccccgaacggcgccgcgtccttcggctggttcgcctac
tcgccgctgaacagcaaggtgtactcgccgggggccgggtcggacctgtggatcgtgggt
ctcgcggtctccggtgtcggtaccatcctcggcgccgtcaacatgatcacgacgatcctg
acgatgcgggccccgggcatgacgatgttccggctgccgatcttctgctggaccttcctg
gcgacctcgatcctcgtgctgatcgccttccccgtgctcgccgcggcgctgctcgccctg
gaggccgaccggcgcttcggcgcgcacgtgttcgacgccgccaacggcggcgcgctgctc
tggcagcacctgttctggtacttcggccaccccgaggtctacatcatcgccctgccgttc
ttcggcgtcatcagcgagatcctgccggtcttctcccgcaagccgctgttcggctacaag
ggtctggtcttcgccaccatcggcatcgcagccctgtccgtcgtggtgtgggcgcaccac
atgttcgtcaccggcgcggtgctactgcccttcttcgcgctgatgtcgttcctcatcgcg
gtaccgaccgggatcaagttcttcaactggatcggcacgatgtggcgcgggcagctcacc
ttcgagacgccgatgctgttcgcgatcggtttcctggtgaccttcctgttcggtggtctg
accggggtactgctggccagcccgccgatcgacttccacgtcagcgacagctacttcgtc
gtcgcccacttccactacgtcgtcttcgggaccgtggtgttcgccgcctacggcggcacc
tacttctggttcccgaaggtcacgggccggctgatgaacgaccggctcgggaagatccac
ttctggacggtcttcctcggcttccacacgacgtttctggtgcagcactggctcggcgtg
cagggtatgccccgccggtacgccgactacggaccgaacgacgggttcaccacgctgaac
acgatctcgtccgcgggttcgttcctgctcgccctctcgacgctgccgttcatctacaac
ctctggcactcctaccgcaagggcccactcgccgtcgtcgacgacccctggggctacggg
aactcgctggaatgggcgacctcctgccccccgccgcggcacaacttccggacgctgccg
cgcatccgctccgaacgcccggcgttcgacctgcactatccccaggcagccggccgcatc
gactatcatgcgacccccgagatcacactgacacccgagaccacgccgaggcccgagacc
gcggacccggccgaatccacagcggccgaatccacagcggccggacccgaccgcccggcg
ccggaatccggcttcaggacgccggaataa

DBGET integrated database retrieval system