KEGG   Frankia sp. CcI3: Francci3_3905Help
Entry
Francci3_3905     CDS       T00320                                 

Definition
magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fra  Frankia sp. CcI3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Francci3_3905
Enzymes [BR:fra01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Francci3_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
4672699..4674222
Genome map
AA seq 507 aa AA seqDB search
MAASAYRQRVEDLPAQPSHSIPPTVPPTVASAVHPPTAAAPQFTTLGGLRRSGHAHRPVR
TELRDNLVALMQGDGPRFPGIVGFDETVLPQVERAILAGHDIVFLGERGQGKTRLIRTLV
SLLDEWSPAVAGCEINDHPYAPVCGRCRALAADLGDALPVVWRHRGERFSEKLATPDTSV
GDLIGDVDPVKVAEGRTLGDPETVHYGLVPRTNRGIFSVNELPDLAERIQVALLNVLEER
DIQVRGYLLRLPLDLLLVASANPEDYTNRGRIITPLKDRFGAEVRTHYPLHLTDELALIR
QEAVMSWAGSPLGAPEIPDHLVEIVARFTRLVRDAPQVDQRSGVSARLSVAAAETVAASA
VRRAALTGEETPTARVVDLAAIVPAVRGKVEFDQLEEGREDEVLALLLRRAVAETFRARL
AGADLTGLQARFDADGPVETGDLVAAAELLRRVGPVPGLAAILTRLGVDGAESPGLAAAA
LELAMEGLHLNRRLAKEELPGRTVYGT
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcgtcggcgtaccgtcaacgggtggaggatctgccggcacagcccagtcattcc
ataccaccgaccgtgcccccgaccgtggcatctgcggtccacccgccgacggccgccgcc
ccgcagttcaccaccctgggtgggctgcgccgcagcgggcacgcgcaccgcccggtgcgg
acggagctgcgcgacaacctcgtcgccctgatgcagggcgacggcccccggttcccgggc
atcgtcggtttcgacgagaccgtccttccccaggtcgagcgggccatcctggccggtcac
gacatcgtcttcctcggcgagcgcgggcagggcaagacccggctcatccgcactctggtg
agtctgctcgacgagtggtcgccggccgtcgccggctgtgagatcaacgaccacccctac
gcgccggtctgcggccgatgccgggcgctggcggccgatctcggtgacgcgctgccggtg
gtctggcggcaccgcggcgagcggttcagcgagaagctcgcgaccccggacacgagcgtc
ggcgacctcatcggcgacgtcgacccggtgaaggtcgccgagggccgcacgctcggcgat
cccgagacggtccactacgggctggtgccacgcaccaaccgcgggatcttcagcgtcaac
gagctgcccgacctcgccgaacggatccaggtcgcgctgctcaacgtgctggaggagcgg
gacatccaggtccgcggctacctgctccggttgccgctggacctgctgctggtcgcctcg
gccaaccccgaggactacaccaaccgggggcggatcatcacgccgctcaaggaccggttc
ggcgccgaggtccgcacccactacccgctgcacctcaccgacgaactggcgctgatccgc
caggaggcggtgatgtcctgggcggggtccccgctcggcgcaccggagatacccgatcac
ctggtggagatcgtggcccggttcacccggctggtgcgcgacgccccccaggtcgaccag
cgctcgggggtgtcggcccggctgtcggtggccgcggccgagacggtggcggcttcggcg
gtccgccgcgcggcgctgaccggcgaggagacgcccaccgcacgggtggtcgacctcgcc
gcgatcgtcccggcggtacgcggcaaggtcgagttcgaccagctggaggagggccgggag
gacgaggtcctcgcgctgctgttgcgccgcgcggtggccgagacattccgggcaaggctg
gccggcgcggacctcaccggcctgcaggcccgcttcgacgcggatggcccggtcgagacc
ggcgacctggtagcggcggccgagctgctgcgccgggtcgggccggtgcccgggctcgcg
gcgatcctgaccaggctcggcgtggacggggcggagtcgccggggctcgcggcggccgcg
ctggagctggcgatggagggactgcacctcaaccgccggctggccaaggaagagcttccc
ggacggaccgtctacggcacctga

DBGET integrated database retrieval system