KEGG   Frankia sp. CcI3: Francci3_3940Help
Entry
Francci3_3940     CDS       T00320                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fra  Frankia sp. CcI3
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Francci3_3940
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Francci3_3940
Enzymes [BR:fra01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Francci3_3940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4717498..4718127)
Genome map
AA seq 209 aa AA seqDB search
MIITPTPIAGVMIVDVEPFPDARGMFARTFCADEFAAAGLTVDVAQCSVAYNASAGTVRG
MHWAGEPVRETKLVRCTRGALLDVVVDPRPDSPTYLRHVAVELSADNHRALFIDAGLAHG
YQTLVDSTEATYQMNVPFTPGHDRGLRFDDPRLGIVWPLPVSVISDKDRAWPLLAGDGPA
GPSGDAAPPGPPGIQRDVAHASGGVGATA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgatcattacgccgacgccgatcgccggggtgatgatcgtcgatgtcgagccgttcccc
gatgcccgcggcatgttcgcgcgcacgttctgtgccgacgagttcgccgccgcggggctc
acggtcgacgtcgcccagtgcagcgtggcctacaacgcctccgcgggcaccgtccgcggg
atgcactgggcgggggagccggtgcgggagaccaagctggtgcgctgcacccgcggcgcc
ctgctcgacgtcgtcgtcgatccccgcccggactcgccgacctatctgcggcacgtggcg
gtggagctctcggccgacaaccatcgggcgctgttcatcgacgcgggcctggcgcacggg
taccagacgctcgtcgactccaccgaggcgacctatcagatgaacgtcccgttcacgccg
ggacacgaccgtgggctgcgcttcgacgacccgcgactgggcatcgtctggccgctgccc
gtctcggtgatctccgacaaggaccgtgcgtggccgctgctggccggcgatggcccggcc
ggaccatccggcgacgccgcgccacccggccctcccggcatccaacgtgatgtagctcac
gcatccggcggggtcggcgcgacggcctga

DBGET integrated database retrieval system