KEGG   Frankia sp. CcI3: Francci3_4040Help
Entry
Francci3_4040     CDS       T00320                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fra  Frankia sp. CcI3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Francci3_4040
   00052 Galactose metabolism
    Francci3_4040
   00500 Starch and sucrose metabolism
    Francci3_4040
   00520 Amino sugar and nucleotide sugar metabolism
    Francci3_4040
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Francci3_4040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(4825318..4826364)
Genome map
AA seq 348 aa AA seqDB search
MSCALPVLGPWTVPVSTDPTKVSAMPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPA
IEYVVEEASRAGLRDVLLVTSRTKKAIEDHFDREADIEAALERKGDDLRLRRVRVSAELA
EVHSVRQQSPRGLGHAVLCAAAHVGNEPFAVLLGDDLIDERDLLLEEMLAVQRRFGGSVI
ALMEVPEDQVSLYGVATVESVGTSAGTGSADDRYGIVRIRDLVEKPPVAQAPSNLAIIGR
YILSPTIFDVLRRTEPGRGGEIQLTDALRILALRAVEPAGAAGDAGTDTAAEPVHGVIFT
GRRYDTGDRVDYLKAVIRLACERADLGPELYPWIEEYVASGGPKAALS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgagctgtgcattgcctgtgctggggccgtggacggtgcccgtgtccacggacccgact
aaggtttcggctatgccagtaacgaaggcggtcattccagccgcgggtctggggacccgc
ttcctgccggcgacgaaggccgtccccaaggagatgctgccggtcgtcgacaggccggct
atcgaatacgtcgtcgaggaggcgtcccgcgccggcctgcgcgatgtcctgcttgtcaca
agccgcacgaaaaaggcgatcgaggatcatttcgatcgtgaggcggacatcgaggcggcc
ctcgaacggaagggtgacgatcttcgtctccgtcgggtccgggtgtcggcggaactggcc
gaggtccactcggtccgccagcagtcgccgcgtgggctcggtcatgccgtgctctgcgcg
gcggcgcacgtgggaaacgagccgttcgctgtcctcctcggtgacgatctcatcgacgag
cgggacctgctgctcgaggagatgcttgccgtgcagcgccgcttcgggggcagcgtcatc
gccctgatggaggtgcccgaggaccaggtctccctctacggcgtcgccacggtggagtcc
gtcggcaccagtgccggcaccggcagtgccgacgaccggtacgggatcgtgcggatccgt
gacctggtcgagaagccaccggtcgcgcaggccccgagcaatctggcgatcatcgggcgg
tacatcctctcgccgacgatcttcgacgtcctgcggcggaccgagccgggacggggcggg
gagatccagctcaccgacgccctgcggatcctggcgctacgggcggtcgaaccggccggt
gccgcgggggacgccggcaccgacactgccgccgagcccgtgcacggggtgatcttcacg
ggtcggcggtacgacaccggtgaccgggtggactacctgaaggccgtcatccggctcgcg
tgcgagcgcgccgaccttggccccgagctgtacccgtggatcgaggagtatgtcgcgtcc
ggtggtccgaaggcagcattgtcctga

DBGET integrated database retrieval system