KEGG   Frankia sp. CcI3: Francci3_4040Help
Entry
Francci3_4040     CDS       T00320                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fra  Frankia sp. CcI3
Pathway
fra00040  Pentose and glucuronate interconversions
fra00052  Galactose metabolism
fra00500  Starch and sucrose metabolism
fra00520  Amino sugar and nucleotide sugar metabolism
fra01100  Metabolic pathways
fra01130  Biosynthesis of antibiotics
Module
fra_M00362  Nucleotide sugar biosynthesis, prokaryotes
fra_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Francci3_4040
   00052 Galactose metabolism
    Francci3_4040
   00500 Starch and sucrose metabolism
    Francci3_4040
   00520 Amino sugar and nucleotide sugar metabolism
    Francci3_4040
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Francci3_4040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABD13390
JGI: Francci34040
RhizoBase: Francci3_4040
UniProt: Q2J5Q2
Position
complement(4825318..4826364)
Genome map
AA seq 348 aa AA seqDB search
MSCALPVLGPWTVPVSTDPTKVSAMPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPA
IEYVVEEASRAGLRDVLLVTSRTKKAIEDHFDREADIEAALERKGDDLRLRRVRVSAELA
EVHSVRQQSPRGLGHAVLCAAAHVGNEPFAVLLGDDLIDERDLLLEEMLAVQRRFGGSVI
ALMEVPEDQVSLYGVATVESVGTSAGTGSADDRYGIVRIRDLVEKPPVAQAPSNLAIIGR
YILSPTIFDVLRRTEPGRGGEIQLTDALRILALRAVEPAGAAGDAGTDTAAEPVHGVIFT
GRRYDTGDRVDYLKAVIRLACERADLGPELYPWIEEYVASGGPKAALS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgagctgtgcattgcctgtgctggggccgtggacggtgcccgtgtccacggacccgact
aaggtttcggctatgccagtaacgaaggcggtcattccagccgcgggtctggggacccgc
ttcctgccggcgacgaaggccgtccccaaggagatgctgccggtcgtcgacaggccggct
atcgaatacgtcgtcgaggaggcgtcccgcgccggcctgcgcgatgtcctgcttgtcaca
agccgcacgaaaaaggcgatcgaggatcatttcgatcgtgaggcggacatcgaggcggcc
ctcgaacggaagggtgacgatcttcgtctccgtcgggtccgggtgtcggcggaactggcc
gaggtccactcggtccgccagcagtcgccgcgtgggctcggtcatgccgtgctctgcgcg
gcggcgcacgtgggaaacgagccgttcgctgtcctcctcggtgacgatctcatcgacgag
cgggacctgctgctcgaggagatgcttgccgtgcagcgccgcttcgggggcagcgtcatc
gccctgatggaggtgcccgaggaccaggtctccctctacggcgtcgccacggtggagtcc
gtcggcaccagtgccggcaccggcagtgccgacgaccggtacgggatcgtgcggatccgt
gacctggtcgagaagccaccggtcgcgcaggccccgagcaatctggcgatcatcgggcgg
tacatcctctcgccgacgatcttcgacgtcctgcggcggaccgagccgggacggggcggg
gagatccagctcaccgacgccctgcggatcctggcgctacgggcggtcgaaccggccggt
gccgcgggggacgccggcaccgacactgccgccgagcccgtgcacggggtgatcttcacg
ggtcggcggtacgacaccggtgaccgggtggactacctgaaggccgtcatccggctcgcg
tgcgagcgcgccgaccttggccccgagctgtacccgtggatcgaggagtatgtcgcgtcc
ggtggtccgaaggcagcattgtcctga

DBGET integrated database retrieval system