KEGG   Frankia sp. CcI3: Francci3_4397Help
Entry
Francci3_4397     CDS       T00320                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fra  Frankia sp. CcI3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fra01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fra00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fra00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5255296..5256573
Genome map
AA seq 425 aa AA seqDB search
MTLAPERATSPTLEVANPAVSLSCRHCGATYPLSPTHVCVECFAPLEIAYDPDLLARVTR
ESIERGPANLWRYVGLLPAGHDPARRVSLGAGWTPLRPAPRLAAELGMKTLYIKDDSANP
THSFKDRVVSVALTAARELGFTTVACASTGNLAQSVAAHAAGAGLRSVVLVPHDLEAGKT
VSTGVYGGTLVAIQGNYDDVNRLCSELAGEYEWAFVNVNVRPFYAEGSKTLGYEVAEQLG
WRLPEQVVVPIASGSLLTKIDKAFGELGRLGLVEPTPYRVFGAQAAGCNPVAAAFARGVE
TVAPVRPATIAKSLSIGNPADGPYALDVARRTGGAITDVTDEEIIDGIRLLARAEGVFGE
TAGGVTVATLRRLLREGLLDPAAETVLYNTGDGLKTLDPLVETGGPTATIKPSLRAFEAA
GLGDD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgcgcccgagcgtgccaccagtcccaccctcgaggtcgcgaaccccgcggtc
tcgctgtcctgtcggcactgcggcgccacctacccgctgtcccctacgcatgtgtgcgtg
gaatgcttcgctcctctggaaatcgcctacgacccggacctgctggctcgtgtgacccga
gagtccatcgaacgtggtccggcgaacctgtggcgttacgtcgggctgctgcccgccggg
catgacccggcgcggcgggtctccctcggggccggctggacgccactgcgcccggccccg
aggctcgccgcggagctggggatgaagacgctctatatcaaggacgacagcgccaacccc
acccactccttcaaggaccgggtcgtctccgtggcgctcaccgccgcccgtgagctgggc
ttcaccacggtcgcctgcgcctcgacgggcaacctcgcgcagtcggtggcggcgcacgcg
gccggtgccgggctgcgctcggtggtgctcgtaccgcacgacctcgaggctggcaagacg
gtctccaccggggtgtacggcgggacgctggtcgccatccagggcaactacgacgacgtg
aaccggttgtgcagcgagctggccggagagtacgaatgggcgttcgtcaacgtcaacgtc
cgccccttctacgccgagggatccaagacgctcggctacgaggtcgccgagcagctcggc
tggcggctgcccgagcaggtcgtcgtgccgatcgcctccggttcactgctaacaaagatc
gacaaggccttcggtgagctcggccggctcggcctggtcgagccgacgccgtacagggtg
ttcggtgcgcaggcggccggctgcaacccggtggccgccgcgttcgcccgcggcgtcgag
acggtcgccccggtccggcccgccacaatcgccaagtcgctgtcgatcggcaacccggcc
gacggcccctacgccctcgacgtggctcggcggaccggcggggctatcacggacgtgacc
gacgaggagatcatcgacgggatccggctgctcgcccgcgccgagggcgtcttcggcgag
acggccggtggcgtcaccgtggccaccctgcgcaggctgctgcgcgaggggctgctcgac
ccggccgccgaaaccgtcctttacaacaccggcgatgggctgaagacgctcgaccccctc
gtcgagacgggcggaccgaccgcgacgatcaagccgtcgctgcgcgccttcgaggccgcc
ggcctcggcgacgactga

DBGET integrated database retrieval system