KEGG   Frankia sp. CcI3: Francci3_4397Help
Entry
Francci3_4397     CDS       T00320                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fra  Frankia sp. CcI3
Pathway
fra00260  Glycine, serine and threonine metabolism
fra00750  Vitamin B6 metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra01230  Biosynthesis of amino acids
Module
fra_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Francci3_4397
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Francci3_4397
Enzymes [BR:fra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Francci3_4397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP MerR MmgE_PrpD HypA NinF
Motif
Other DBs
NCBI-ProteinID: ABD13743
JGI: Francci34397
RhizoBase: Francci3_4397
UniProt: Q2J4P9
Position
5255296..5256573
Genome map
AA seq 425 aa AA seqDB search
MTLAPERATSPTLEVANPAVSLSCRHCGATYPLSPTHVCVECFAPLEIAYDPDLLARVTR
ESIERGPANLWRYVGLLPAGHDPARRVSLGAGWTPLRPAPRLAAELGMKTLYIKDDSANP
THSFKDRVVSVALTAARELGFTTVACASTGNLAQSVAAHAAGAGLRSVVLVPHDLEAGKT
VSTGVYGGTLVAIQGNYDDVNRLCSELAGEYEWAFVNVNVRPFYAEGSKTLGYEVAEQLG
WRLPEQVVVPIASGSLLTKIDKAFGELGRLGLVEPTPYRVFGAQAAGCNPVAAAFARGVE
TVAPVRPATIAKSLSIGNPADGPYALDVARRTGGAITDVTDEEIIDGIRLLARAEGVFGE
TAGGVTVATLRRLLREGLLDPAAETVLYNTGDGLKTLDPLVETGGPTATIKPSLRAFEAA
GLGDD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacactcgcgcccgagcgtgccaccagtcccaccctcgaggtcgcgaaccccgcggtc
tcgctgtcctgtcggcactgcggcgccacctacccgctgtcccctacgcatgtgtgcgtg
gaatgcttcgctcctctggaaatcgcctacgacccggacctgctggctcgtgtgacccga
gagtccatcgaacgtggtccggcgaacctgtggcgttacgtcgggctgctgcccgccggg
catgacccggcgcggcgggtctccctcggggccggctggacgccactgcgcccggccccg
aggctcgccgcggagctggggatgaagacgctctatatcaaggacgacagcgccaacccc
acccactccttcaaggaccgggtcgtctccgtggcgctcaccgccgcccgtgagctgggc
ttcaccacggtcgcctgcgcctcgacgggcaacctcgcgcagtcggtggcggcgcacgcg
gccggtgccgggctgcgctcggtggtgctcgtaccgcacgacctcgaggctggcaagacg
gtctccaccggggtgtacggcgggacgctggtcgccatccagggcaactacgacgacgtg
aaccggttgtgcagcgagctggccggagagtacgaatgggcgttcgtcaacgtcaacgtc
cgccccttctacgccgagggatccaagacgctcggctacgaggtcgccgagcagctcggc
tggcggctgcccgagcaggtcgtcgtgccgatcgcctccggttcactgctaacaaagatc
gacaaggccttcggtgagctcggccggctcggcctggtcgagccgacgccgtacagggtg
ttcggtgcgcaggcggccggctgcaacccggtggccgccgcgttcgcccgcggcgtcgag
acggtcgccccggtccggcccgccacaatcgccaagtcgctgtcgatcggcaacccggcc
gacggcccctacgccctcgacgtggctcggcggaccggcggggctatcacggacgtgacc
gacgaggagatcatcgacgggatccggctgctcgcccgcgccgagggcgtcttcggcgag
acggccggtggcgtcaccgtggccaccctgcgcaggctgctgcgcgaggggctgctcgac
ccggccgccgaaaccgtcctttacaacaccggcgatgggctgaagacgctcgaccccctc
gtcgagacgggcggaccgaccgcgacgatcaagccgtcgctgcgcgccttcgaggccgcc
ggcctcggcgacgactga

DBGET integrated database retrieval system