KEGG   Frankia sp. CcI3: Francci3_4405Help
Entry
Francci3_4405     CDS       T00320                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fra  Frankia sp. CcI3
Pathway
fra00790  Folate biosynthesis
fra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Francci3_4405
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Francci3_4405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ABD13751
JGI: Francci34405
RhizoBase: Francci3_4405
UniProt: Q2J4P1
Position
complement(5266946..5267551)
Genome map
AA seq 201 aa AA seqDB search
MAGDRMMTRPEHAVLSLGSNLGDRLGRLSAAVHRLDRALGVLAGSPVYETAPVGGPEQDD
YLNAVVLVRPAPPRDLLEVVREVEERAARVRAVRWGPRTLDVDVIAIGDLRSDDPEILVP
HPRAHLRAFVCVPWLDVDPEATLPGHGRVADLVARMAAGKHPAGLRRIPWSLSDPVVEAD
PGADAVTDPAVGGSDAEEAAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtgaccggatgatgacccggccggagcatgcggtgctgtcgctcgggtccaac
ctcggcgatcgtctgggccggctgtccgccgccgtccatcggctcgaccgcgcgctgggg
gtgctcgccggctcaccggtgtacgagacggcacccgtcggtggacccgagcaggacgac
tacctgaacgccgtcgtcctggtgcgcccggcacccccgcgtgatctgctcgaggtcgtc
cgcgaggtggaggaacgggccgcgcgggtccgggccgtccggtggggcccgcgaacgctc
gacgtcgatgtcatcgcgatcggtgacctgcgcagtgacgaccccgagatcctcgtgccg
catccccgagcacatctgcgggccttcgtctgcgtgccctggctggacgttgatcccgag
gcgacgctgcccgggcacgggcgggtcgccgatctggtcgcccggatggccgcggggaag
cacccggccggtctgcgccggatcccgtggtcgctgtcggatcccgtggtcgaggcggat
ccgggggccgatgccgtcaccgatcccgccgtcggcggcagtgacgccgaagaggcggcc
aggtga

DBGET integrated database retrieval system