KEGG   Frankia sp. CcI3: Francci3_4446Help
Entry
Francci3_4446     CDS       T00320                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fra  Frankia sp. CcI3
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Francci3_4446
Enzymes [BR:fra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Francci3_4446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(5313550..5315301)
Genome map
AA seq 583 aa AA seqDB search
MADSGSDGGYDADVIVIGSGFGGSVSALRLAEKGHRVLVLEAGRRFTPDTLPKNSWHVRR
YLWMPRLGCHGIQKITWLGRVVVLSGTAVGGGSVVYANTLYRPLDAFYTDPQWRDITDWR
RELEPFFDQAERMLGVNPNPTTTYSDEVFRTVAEEMRVGSTFAAAPVGVFFGRDGSREPG
VRVPDPYFGGAGPARTGCVECGECMSGCRRGAKNTLDCNYLYLAERAGVRVVPDTTVTAV
RPRSTGGYELDMVRTGGLVRRRRRTLTAEQVVFAAGTLGTQRLLLAMKQSGDLPALSDRL
GHLTRTNSEAILGASRLRPDQRIARGVAITSSFHPDEHTHIEPVRYGRGSNLMALISASM
TDGGGRVPRWLKYLRQVVLHPHQALASSLPWRWSERTIIALVMQSWDNSLIVSLRRGPFG
LGWLTSRQGHGEPNPSWIPEGNDAARRIAARMGGYPGGSIGEIANIPLTAHILGGAPIGT
DPTTGVIDPYHRVFGYEGLHVVDGAAVSANLGANPSLTITAQAERAMSFWPNKGEPDPRP
PLGAAYRPVAPRAPAHPAVPAGAPGTYRVVGPVGPVGPVAGTR
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
gtggctgattccgggtcggacggcggctatgacgccgacgtgatcgtgatcgggagcggg
ttcggcggcagcgtcagcgcgctacggctcgcggagaagggccatcgtgtcctcgtgctg
gaggccggtcgccggttcaccccggacacgctgccgaagaacagctggcacgttcgccgg
tatctgtggatgccgcggttgggctgccacggtatccagaagatcacctggttgggtcgg
gtcgtggtgctgtccggaacggcggtcggtggcggctcggtcgtctacgcgaacacgctg
taccgcccgctcgacgccttctataccgacccgcagtggcgggacatcaccgactggcgc
cgtgagctggagccgttcttcgaccaggccgaacgcatgctcggggtgaatcccaacccg
acgacgacgtactccgacgaggtgttccgcacggtcgccgaggagatgcgggtcgggtcc
accttcgcggcggcgccggtcggtgtcttcttcggccgcgacggcagccgggaacccggc
gtgcgtgtccctgacccgtacttcggcggcgccggcccggctcggacgggatgcgtagag
tgcggggagtgcatgagcggctgccgtcgaggggccaagaacaccctcgactgtaactac
ctgtacctggccgagcgggccggtgtgcgggtagtcccggacaccacggtcacggctgtc
cggccacgctcgaccggcgggtatgagctcgacatggtccggacggggggtctcgtccgg
cgtcggcgacgtaccctcaccgcggagcaggtcgtgttcgccgccggcaccctgggcacc
cagcggctgctgctggcgatgaaacagagcggtgacctgccggcgttgtccgaccggctc
ggtcatctcacccggacgaactccgaggcgatcctgggcgcatccaggctgcgccccgat
cagcggatcgcccggggagtcgcgatcacctcgtccttccaccccgacgagcacacccac
atcgaacccgtgcgctacggccgggggagcaacctgatggcactgatcagcgcgtcgatg
accgacggcggcgggcgggtgccgcgctggctgaaatacctgcgtcaggtcgtgctccac
ccacatcaggcgctggcgtcgtcactgccctggcgatggtccgagcggaccatcattgcg
ctggtcatgcagtcgtgggacaactcgttgatcgtctccctgcgccgtgggccgttcggt
ctcggctggctgacgagtcggcagggacacggtgagccgaacccctcctggatcccggag
ggcaacgatgccgcccgccggatcgcggccaggatgggcggctaccccggcgggtcgatc
ggcgagatcgccaacatcccgctgaccgcgcacatcctcggcggggcccccatcggcacg
gatcccaccaccggagtgatcgatccctaccaccgggtcttcggatacgaggggctgcac
gtcgtcgacggcgccgcggtctcggcgaacctcggcgcgaacccgtcgttgaccatcact
gcgcaggccgaacgggcgatgtccttctggccgaacaagggggaacccgacccgcgccca
cctctcggggcggcctaccggccggttgcgccgagagcaccggcgcaccccgccgtccca
gccggcgctcccgggacctaccgcgtggtcggcccggtcggcccggtcggaccggtcgcg
gggacgaggtga

DBGET integrated database retrieval system