KEGG   Frankia sp. CcI3: Francci3_4467Help
Entry
Francci3_4467     CDS       T00320                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fra  Frankia sp. CcI3
Brite
Enzymes [BR:fra01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Francci3_4467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
5339193..5340395
Genome map
AA seq 400 aa AA seqDB search
MTTRTPEQLRDNLVADIHRWGTFRTAQVEAAFRTVPRHLFLPDVDLETAYAPQVVVTRRA
PDGTALSSASQPSLVAAMLEQAGVHPGHRVLEIGTATGINAALLAELTGPTGQVTTIEID
EELAAGARTALVKAGYERVDVVHADGAAGHPGGAPYDRIVITAGAWDLAKGWWNQLAPAG
RIVVPLRLHGSGLTRSLPLDAVEPGRLVSRSALVCGFVPLRGADAHTGRTLALADGVALH
VDDHDPADEPALRAAAASPPHNLWTGLTIHDDEPTAHLDLWLVTMGARFGRLAVDTTVRP
DSQLTPTRRWAGATIHDGTTIAYVTLRPLASDTDELGVTAHGPHAATLTAHLTDLLHQWR
KEGPAEPVVTAHAADTLEDQTVAGHRVDRPNSRLTVRWQP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacccccgaacagctccgcgacaacctggtcgccgacatccaccgctgg
ggcacattccgaaccgcccaggtcgaagccgcgttccgcacggtcccgcgacacctgttc
ctgcccgacgtcgacctggaaaccgcctacgccccccaggtcgtcgtcacccgccgcgcc
cccgacggcaccgcgctgtcctcagcatcccaacccagcctcgtcgccgccatgctcgaa
caggccggcgtccaccccggccaccgcgtcctggagatcggcaccgccaccggcatcaac
gcagcactcctcgccgaactcaccggcccgaccggccaggtcaccaccatcgagatcgac
gaggagctcgccgcaggcgcgcgcaccgcactggtcaaggccggttacgaacgcgtggac
gttgtccacgccgatggtgcggcgggccacccgggcggagcgccctacgatcggatcgtc
atcacggccggggcctgggacctggccaagggctggtggaaccagctcgcccccgccggt
cgtatcgtcgtgcctctccgtctccacggaagcggcctgacccgctccctcccgctcgac
gccgttgagccgggccggctcgtcagccgctcggcgctcgtctgcggattcgtcccccta
cgtggcgccgacgcccacaccggccgtaccctcgccctcgcagacggtgtcgccctgcac
gtcgacgaccacgaccccgccgacgagccggcgctgcgcgccgcggcggccagcccaccc
cacaacctatggacggggctgacgatccacgacgacgaaccgaccgcgcacctcgacctg
tggctcgtcaccatgggcgcccgcttcggccgcctcgccgtcgacaccaccgtccgccct
gacagccagctcactccgacacggcgctgggccggggccaccatccacgacggcaccacc
atcgcctacgtcaccctgcgtcccctcgcatccgacaccgacgaactcggcgtcaccgcc
cacggaccccacgcggccaccctcaccgcgcacctcaccgatctgctgcaccagtggcgc
aaagaaggccccgccgaacctgtcgtaacggcccatgccgcggacaccctggaggaccag
accgtcgccggacaccgcgtcgatcggccgaacagccgactcaccgtccgctggcagccc
tga

DBGET integrated database retrieval system