KEGG   Frankia sp. EAN1pec: Franean1_0058Help
Entry
Franean1_0058     CDS       T00608                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fre  Frankia sp. EAN1pec
Brite
Enzymes [BR:fre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Franean1_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(72866..74167)
Genome map
AA seq 433 aa AA seqDB search
MFRLWRRETGARPPEGSSLIQMIGTSSAPDRATEVRNALVDKLCVTGMITSLEVERAFRA
VPRHLFVPEGTSLEVAYNADDSVAVKRAADGVIISSISAPFIQARMIEQAGLGPGMSVVE
IGSSGYNAALLAEIVGPSGRVVSVDIDPEVTDRARALLEATGYADRVTVVRADAQDGVAD
HGDRVDAILVTAGAWDLSPAWLAQLAEDGRIVVPLRMNGITRSIGFRRDGDHLVSTSAEV
CGFVPMQGAGAHDERVFLLPDGHGRHVRLRFDANPPQDLDLLDGVLATPRSEVWSGVTIR
NGVSFADLHLWFACFLSGFCRLAADEGTDLAAERKSWFPFGAVQGDSFAYLAVRPALDGA
GVEFGGRAYGPHGEAAATALVEQIQAWDRQARGGPAPTFAYWPTGADRPPAGEGTAVLAK
THGLVSISWPVAG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtctgtggcgccgagagactggggcaagaccgccggaaggatcttcgttgatt
cagatgattggcacgtccagcgccccggaccgggcgactgaggtccgcaacgcgctggtc
gacaagctctgcgtgaccggcatgatcacctcgctggaggtggagcgggcgtttcgtgcc
gtgccgcggcacctgttcgtccctgagggcacctcgctggaggttgcctacaacgccgat
gactcggtggcggtcaagcgggccgcggatggcgtgatcatctcgtcgatcagcgcgccg
ttcattcaggctcggatgatcgagcaggccgggctcggacccgggatgagcgtggtcgag
atcgggtccagcggctacaacgccgcgctcctcgctgagatcgtcggcccctcgggccgg
gtggtcagcgtggacatcgatcctgaggtgaccgatcgagcacgcgcgcttctggaagcg
accgggtacgcggaccgggtcacggtcgttcgcgcggacgcgcaggacggtgtggccgat
cacggtgaccgggtcgacgcgatcctggtgacggccggcgcctgggatctctcgccggcg
tggctcgcgcagctggccgaggacggccggatcgtcgtgccactgcgaatgaacgggatc
acccggtcgatcgggttccgccgcgacggcgatcatctggtgagcacctcggccgaggtg
tgcgggttcgtccccatgcagggcgccggtgcccacgacgagcgggtcttccttctgccg
gatgggcacggccgtcatgtcaggctgcgtttcgacgccaacccgccccaggacctggat
cttctggacggtgtcctggcgacacctcggtccgaggtgtggtccggggtcacgatccgt
aacggtgtgtcgttcgccgacctgcacctgtggttcgcgtgcttcctgtctggcttctgc
cggctggcggcggacgagggaaccgatctggctgctgaacgcaagagctggttccccttc
ggggctgtgcagggcgactcgttcgcctatctggcggtgcgcccggcgctggacggcgcc
ggtgtcgagttcggcgggcgagcgtacggcccgcacggcgaggccgctgctaccgcgctc
gtcgagcagatccaggcctgggatcgccaggcacggggcggaccggccccgaccttcgcc
tactggccgacgggcgccgaccgtccgccggccggcgagggcacggccgtgctggcgaag
acccacggcctggtctcgatctcctggccggtcgctggctga

DBGET integrated database retrieval system