KEGG   Frankia sp. EAN1pec: Franean1_0121Help
Entry
Franean1_0121     CDS       T00608                                 

Definition
glucose-methanol-choline oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fre  Frankia sp. EAN1pec
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Franean1_0121
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Franean1_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
145039..146910
Genome map
AA seq 623 aa AA seqDB search
MVVRHAPFPVSRRTCMPGGMMGHMGGDETERSGADIERRDDCDVLVIGSGFGGSVTALRL
AEKGYRVTVVEAGRRFTPATLPKTSWDIRRYLWLPRLGCHGIQKITLLGRVLVLSGAAVG
GGSVVYANTLYRPLDGFYDDPQWADIADWRAELGPFYGQAERMLGSTRNPSMTMADEVFR
DVARDMGVGDTFRLADVGVFFGRDGQREPGVTVPDPYFGGAGPARTGCVECGECMTGCRR
GAKNTLDRNYLHLAEGLGARIVADTTVRSVRPDGRGGYEVETVRTGSRRRDARRWTARQV
VFAAGALGTQRLLLGMREQGHLPGISDRVGHLTRTNSEAILGATRLRPDGRITRGVAITS
SFYPNDHTHVEPVRYGRGSNLMAFLSSAMTDGGGSLPRWAKHLLLLARRPYLTLLALPWR
WSERTMIALVMQSRDNSLTVSRRRGPFGTSWLTSHAGHGESNPTWIPEGNQAARLVAERL
GGHPGGAITELADIPLTAHILGGAVLAADPARGVIDPYHRVFGHPGLHVVDGSAVPANLG
VNPSLTITAMAERAMAFWPNRGDTDPRPPVGAAYRRIAPVAPRNPAVPADAPGHYEISAL
TSTNTDLPRDAVAGGGRETPHNM
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggtcgtccgtcacgctccgttcccggtgtcccggcgcacctgcatgcctggcggcatg
atggggcacatgggaggcgacgagaccgagcggtcgggcgcggacatcgagcgtcgggac
gactgcgacgttctggtgatcggcagcgggttcgggggcagcgtgaccgcgctccgcctg
gccgagaagggctaccgcgtcacggtcgtcgaggccggccgccggttcaccccggcgaca
ctgccgaagacgagctgggacatccgcaggtacctgtggcttccgcggctcgggtgccac
gggatccagaagatcaccctgctcgggcgggtgctggtgctctccggagcagcggtcggc
ggtggatcggtcgtctacgcgaacacgctgtacaggcccctggacggtttctacgacgat
ccccagtgggcggacatcgccgactggcgtgccgagctcgggccgttctacggccaggcc
gagcgcatgctcggctccacccggaacccgtcgatgaccatggcggacgaggtcttccgg
gacgtcgcacgggatatgggtgtcggggacaccttccgcctggccgacgtcggcgtgttc
ttcggccgcgacggccagcgcgagccgggggtgacggttcccgatccctacttcggcggc
gccggccccgcccggacgggctgcgtcgagtgcggcgagtgcatgacgggatgccggcgc
ggcgcgaagaacaccctggaccgcaactacctccacctggccgaagggctgggcgcccgc
atcgtggcggacacgaccgtgcgctcggtgcgccccgacgggcgcggtggctacgaggtc
gagacggtccgcaccggcagccggcggcgggacgcgcggcgctggacggcccgccaggtc
gtgttcgccgcgggcgccctgggaacccagcgcctcctgctcggcatgcgcgaacagggg
cacctgcccggcatctccgaccgggtcggccacctgaccaggacgaactccgaggcgatc
ctgggcgcgacccggctgcggccggatgggcggatcacccggggggtggccataacgtcg
tccttctacccgaacgatcacacgcacgtggaacctgtccggtacggccggggcagcaac
ctcatggcgttcctgtcgagcgccatgaccgacggcggaggctccctgccacgctgggcg
aagcacctgctgctgctggcccgccgcccgtacctcacgctgctcgccctgccgtggcgg
tggtcggagcgaaccatgatcgctctcgtcatgcagtcccgggacaactcgctcaccgtc
agccggcgccgcgggccgttcgggacgtcctggctgacgagccacgctggccacggggag
tccaacccgacctggataccggagggcaaccaggcggcgcggctggtggcggagcggctg
ggcgggcatccgggaggcgcgatcaccgagctggccgacatcccgctgacggcgcacatc
ctcggcggggcggtcctggccgctgatcccgcccggggcgtgatcgacccgtatcaccgg
gttttcggccatcccggcctgcacgttgtggacggctcggcggtgccggcgaacctcggg
gtgaacccctcgctgacgatcacggcgatggcggagcgggcgatggccttctggccgaac
cggggtgacaccgacccccgcccgccggtgggcgcggcgtaccggcggatcgcgccggtg
gcaccgcggaacccggcggtgcccgcggatgcaccgggacattatgaaataagtgccctg
accagcacgaatactgatcttccccgggatgctgtagctggcggtggccgggagactcct
cacaatatgtga

DBGET integrated database retrieval system