KEGG   Frankia sp. EAN1pec: Franean1_0168Help
Entry
Franean1_0168     CDS       T00608                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fre  Frankia sp. EAN1pec
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Franean1_0168
Enzymes [BR:fre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Franean1_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
201871..202785
Genome map
AA seq 304 aa AA seqDB search
MTGPRDDLFAPDAPTRVMGVVNVTPDSFSDGGAYPDPHDAVRAAQLMIEQGADVIDVGGE
STRPGAPRVVASEELRRVLPVVAQLASAGVPVSVDTSRASVASAAVDAGALLVNDVSCGR
NAELLRIVADRGVHYVLMHSRGSSTDMAAHAVYNDVVTDVVGELAARLDVVLAAGVAEDK
VIIDPGIGFAKTPAHNWALLANLGAVASLGRPLLVGTSRKSFLGAAVSGPGELPRPADER
DDATQATTALLADAGVWAVRVHAVRPAVDAVRVVRAWQQAARASGAGRPRAAVSGSAPAA
GPSR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaccccgtgacgacctgttcgccccggacgccccaacccgggtgatgggcgtc
gtcaacgtcacaccggactcgttctccgacggcggcgcctacccggatccgcatgacgcc
gtccgggccgcgcagctcatgatcgaacagggcgcggacgtcatcgacgtcggcggcgag
tcgacccgtcccggagcgccgcgcgtggtggccagcgaggagctgcgccgggtgctcccg
gtggtggcccagctcgcctccgccggcgtcccggtaagcgtggacactagccgcgcctcg
gtcgcctccgcggccgtggacgccggcgccctgctggtcaacgacgtctcctgcggccgg
aacgcggagctgctgcgcatcgtcgccgaccgcggcgtccactacgtgctgatgcactcc
cgcgggtccagcacggacatggccgcccacgcggtctacaacgatgtggtgaccgacgtg
gtgggcgagctcgccgcccggctggacgtcgtcctggcggccggcgtggcggaggacaag
gtgatcatcgacccgggcatcgggttcgcgaagacgccggcgcacaactgggcgctgctg
gcgaacctcggcgccgtcgcctccctcggccggccgctgctcgtcggcacctcgcgcaag
tcgttcctcggcgcggcggtgagcggcccgggcgagctgccccgcccggcggacgagcgc
gacgacgccacccaggccacgaccgctctgctggcggacgccggggtctgggcggtgcgg
gtgcacgcggtccgccccgcggtggacgccgtccgcgtggtgcgggcctggcagcaggcc
gcccgcgcctccggggccggccggccccgcgcggccgtgtccggcagcgcccccgcggct
ggaccatcccgatga

DBGET integrated database retrieval system