KEGG   Frankia sp. EAN1pec: Franean1_0176Help
Entry
Franean1_0176     CDS       T00608                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Franean1_0176
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Franean1_0176
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Franean1_0176
Enzymes [BR:fre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Franean1_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(213806..215083)
Genome map
AA seq 425 aa AA seqDB search
MTLAPERATLPSPDAANPAVSLSCRHCGATYPLSATHVCVECFAPLEIAYDEDRLRKVTR
ASIEAGPSNLWRYVGLLPAGHVAERRVSLDAGWTPLRPAQRLAAELGMRTLWVKDDSANP
THSFKDRVVSVALTAARELGFHTVACASTGNLAQSVAAHAASAGLRSVVLVPHDLEAGKT
VSTAVYGGTLVAIKGNYDDVNRLCSELAGEYEWAFVNVNVRPFYAEGSKTLGYEVAEQLG
WRIPGQVVVPIASGSLLTKVDKAFGELGRLGLVEPTPYKVFGAQAAGCNPVAAAYARGAD
TVAPVKPSTIAKSLSIGNPADGPYALDVARRTGGAITDVTDDEIVDGIRLLARTEGIFGE
TAGGVTVACLRRLLNEGLLDPDVETVIYNTGDGLKTLDPLVSTGGPTATIPPSLSAFEAA
GLGDD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgactctcgcgcccgagcgcgccactctcccgagcccggacgccgccaaccccgccgtc
tcgctgtcctgtcgtcactgcggtgccacctacccgctgtcggccacccacgtctgcgtc
gagtgtttcgcgccgctcgagatcgcctacgacgaggaccggctgcgcaaggtcacccgg
gcgtcgatcgaggccgggccgtccaacctgtggcggtacgtcggcctgctgcccgccggg
cacgtcgccgaacggcgcgtctcgctcgacgccggctggaccccgctgcgacccgcccag
cgcctcgccgccgagctcggcatgcgcaccctgtgggtcaaggacgacagcgcgaacccg
acccactcgttcaaggaccgggtcgtctcggtggccctcaccgccgcccgcgagctcggc
ttccacaccgtcgcctgcgcgtccaccgggaacctcgcccagtccgtcgccgcccacgcc
gcgtccgccggcctgcgctcggtcgtgctcgtcccgcacgacctggaagccggcaagacc
gtgtcgacggccgtgtacggcggcaccctcgtcgcgatcaagggcaactacgacgacgtc
aaccggctgtgcagcgagctggccggcgagtacgagtgggcgttcgtcaacgtcaacgtc
cggccgttctacgcggagggctcgaagacgctcggctacgaggtcgccgagcagctcggc
tggcgcatccccggccaggtcgtggtgccgatcgcctccggctccctgctgaccaaggtc
gacaaggcgttcggtgagctcggccgcctcgggctcgtcgagcccaccccgtacaaggtc
ttcggcgcccaggccgccggctgcaaccccgtcgccgccgcctacgcccgcggcgccgac
acggtcgccccggtgaagccgtcgacgatcgccaagtccctctcgatcggcaacccggcg
gacggcccctacgccctcgacgtcgcccgccgcaccggcggcgccatcaccgacgtcacc
gacgacgagatcgtggacggcatccgcctcctggcccgcaccgaggggatcttcggggag
accgccggcggcgtcaccgtcgcctgcctgcgccgcctgctgaacgaaggcctcctcgac
ccggacgtcgagacggtgatctacaacaccggcgacgggctgaagaccctcgaccccctg
gtctccacaggtggtcccaccgccacgatcccgccctcgctctccgcgttcgaggccgcc
ggcctcggcgacgactag

DBGET integrated database retrieval system