KEGG   Frankia sp. EAN1pec: Franean1_0296Help
Entry
Franean1_0296     CDS       T00608                                 

Definition
cyclic nucleotide-binding protein (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fre  Frankia sp. EAN1pec
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Franean1_0296
   00330 Arginine and proline metabolism
    Franean1_0296
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Franean1_0296
Enzymes [BR:fre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Franean1_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
347677..349551
Genome map
AA seq 624 aa AA seqDB search
MRAGGNARPAKDSRLRAPDAGPMERMLADIHEAFRTDRSGKVASFIPELATADPALFGLA
VTTMDGLRYRAGDSDVPFTIQSVSKPFVYALALRDRGTDGVLARVGVEPTGDAFNAITLE
PETGRPLNPMVNAGALLTSSLVGGGDAAERFDRVLTGLSAFAGRQLTVNERVFASERDTG
DRNRAIGYLMRGAGALRGPVDEICEVYFRQCAVEVTAADLAVMAGTLARGGVNPLTGERV
LNEEHVNHVLTVMATCGMYDRAGTWLFRVGLPAKSGVAGGVCAVLPGQLGIGVFSPPLDE
VGNSVRGVRACERLASRFALHLLAPQGEPPHPVRGTHRGDALSSKRMRGARERAVLAVRG
SAIVIHELQGDLVFASAERVVRTVRQHLDDVRWVVLDLRRVAAVREPALELLRVLLDELA
SRDVNVLFADPRGLPGVDRLMRGDWSTQRVPDLETALEWAEEALLMREDLATLPPTAHVP
LGAQELLTDLGKEGTRVIGAMCERRTYERGATVFDEGDPADALYFVTRGLANAQAPNADG
TRWFRLSSVPAGSAFGELALVDGGRRSTRIVVAETMTCEVLSVAAFDTLVREHPDVYNAL
VRAIARSLSAQLRRATREIQSLEE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgggcgggaacgcacggccagccaaggactcccgtctacgagcaccggacgcc
ggtccgatggagcggatgcttgcggacatccatgaggctttccgcaccgaccggtcgggg
aaggtcgccagcttcatccccgagctcgcgaccgcggacccggccctgttcggcctcgcc
gtcacgacgatggacgggctgcgctaccgggcgggcgacagcgacgtcccgttcacgatc
cagtcggtgtcgaagccgttcgtttacgcgctggccctgcgtgaccgcgggaccgacggt
gtgctggccagggtcggggtcgagccgaccggcgacgccttcaacgcgatcacgctcgag
ccggagaccggccgtccgctgaacccgatggtgaatgccggggcgctgctcacctccagc
ctggtgggcggcggtgacgcggccgagcgtttcgaccgtgtcctgacgggtctgtcggcg
ttcgcgggcaggcagctgaccgtgaatgagcgggtcttcgcctccgagcgggacaccggt
gatcgaaaccgtgcgatcggctacctgatgcgtggcgcgggggcgctgcgggggccggtg
gacgagatctgtgaggtctacttccggcagtgcgccgtggaggttaccgcggcggacctc
gcggtgatggccggcaccctcgcccgcggcggggtgaacccgctgaccggcgagcgcgtc
ctgaacgaggagcacgtcaaccatgtgctgaccgtcatggcgacctgcggcatgtacgac
cgggcgggaacctggctgttccgggtgggcctgcccgcgaagagcggggtcgccggagga
gtgtgcgcggtgctgcccgggcagctcgggatcggcgtcttcagcccgccgctcgacgag
gtgggcaacagcgtccgcggcgtgcgcgcctgcgagcggctggcctcccggttcgcactg
catctccttgccccgcagggagaaccgccgcacccggtgcggggcacgcaccgtggcgac
gcgctgagctcgaagcggatgcgaggcgcgcgggaacgggccgtcctcgccgtacggggt
tccgcgatcgtcatccacgagctgcagggcgatctggtgttcgccagcgcggagcgggtt
gtgcgcaccgtccgccagcacctggacgacgtccgctgggtggtgctcgacctgcgccgg
gtggccgccgtccgggagcccgccctcgagctcctgcgggtgctgctcgacgagctggcc
agccgggacgtcaacgtcctgttcgccgacccgcgtgggcttccgggcgtcgaccgcctg
atgcggggggactggagcacgcagcgcgttcccgatctggagaccgcactcgaatgggcg
gaggaggcgctgctgatgcgcgaggacctcgcgaccctcccgccgaccgcgcacgtcccg
ctcggcgcgcaggaactgctcaccgatctcggcaaggagggcacccgggtcatcggcgcg
atgtgcgaacgacgcacctacgaacgcggcgcgacggtcttcgacgagggagatccggcg
gacgcgctctacttcgtcaccaggggcctggcgaacgcgcaggcgccgaacgcggacggg
acgcgctggttccggctcagctcggttccagccggcagtgcgttcggtgagctggcactc
gtcgatggcggccggcgttccacccggatcgtcgtcgcggagaccatgacctgcgaggtg
ctctcggtcgcggcgttcgacaccctggtgcgggagcatccggacgtctacaacgcgctg
gtgcgcgcgatcgcgcgcagcctctcggcacagctgcgccgagcgacccgggagatccag
tcgctcgaagagtga

DBGET integrated database retrieval system