KEGG   Frankia sp. EAN1pec: Franean1_0296Help
Entry
Franean1_0296     CDS       T00608                                 

Definition
cyclic nucleotide-binding protein (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fre  Frankia sp. EAN1pec
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fre00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fre00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:fre00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
347677..349551
Genome map
AA seq 624 aa AA seqDB search
MRAGGNARPAKDSRLRAPDAGPMERMLADIHEAFRTDRSGKVASFIPELATADPALFGLA
VTTMDGLRYRAGDSDVPFTIQSVSKPFVYALALRDRGTDGVLARVGVEPTGDAFNAITLE
PETGRPLNPMVNAGALLTSSLVGGGDAAERFDRVLTGLSAFAGRQLTVNERVFASERDTG
DRNRAIGYLMRGAGALRGPVDEICEVYFRQCAVEVTAADLAVMAGTLARGGVNPLTGERV
LNEEHVNHVLTVMATCGMYDRAGTWLFRVGLPAKSGVAGGVCAVLPGQLGIGVFSPPLDE
VGNSVRGVRACERLASRFALHLLAPQGEPPHPVRGTHRGDALSSKRMRGARERAVLAVRG
SAIVIHELQGDLVFASAERVVRTVRQHLDDVRWVVLDLRRVAAVREPALELLRVLLDELA
SRDVNVLFADPRGLPGVDRLMRGDWSTQRVPDLETALEWAEEALLMREDLATLPPTAHVP
LGAQELLTDLGKEGTRVIGAMCERRTYERGATVFDEGDPADALYFVTRGLANAQAPNADG
TRWFRLSSVPAGSAFGELALVDGGRRSTRIVVAETMTCEVLSVAAFDTLVREHPDVYNAL
VRAIARSLSAQLRRATREIQSLEE
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgggcgggaacgcacggccagccaaggactcccgtctacgagcaccggacgcc
ggtccgatggagcggatgcttgcggacatccatgaggctttccgcaccgaccggtcgggg
aaggtcgccagcttcatccccgagctcgcgaccgcggacccggccctgttcggcctcgcc
gtcacgacgatggacgggctgcgctaccgggcgggcgacagcgacgtcccgttcacgatc
cagtcggtgtcgaagccgttcgtttacgcgctggccctgcgtgaccgcgggaccgacggt
gtgctggccagggtcggggtcgagccgaccggcgacgccttcaacgcgatcacgctcgag
ccggagaccggccgtccgctgaacccgatggtgaatgccggggcgctgctcacctccagc
ctggtgggcggcggtgacgcggccgagcgtttcgaccgtgtcctgacgggtctgtcggcg
ttcgcgggcaggcagctgaccgtgaatgagcgggtcttcgcctccgagcgggacaccggt
gatcgaaaccgtgcgatcggctacctgatgcgtggcgcgggggcgctgcgggggccggtg
gacgagatctgtgaggtctacttccggcagtgcgccgtggaggttaccgcggcggacctc
gcggtgatggccggcaccctcgcccgcggcggggtgaacccgctgaccggcgagcgcgtc
ctgaacgaggagcacgtcaaccatgtgctgaccgtcatggcgacctgcggcatgtacgac
cgggcgggaacctggctgttccgggtgggcctgcccgcgaagagcggggtcgccggagga
gtgtgcgcggtgctgcccgggcagctcgggatcggcgtcttcagcccgccgctcgacgag
gtgggcaacagcgtccgcggcgtgcgcgcctgcgagcggctggcctcccggttcgcactg
catctccttgccccgcagggagaaccgccgcacccggtgcggggcacgcaccgtggcgac
gcgctgagctcgaagcggatgcgaggcgcgcgggaacgggccgtcctcgccgtacggggt
tccgcgatcgtcatccacgagctgcagggcgatctggtgttcgccagcgcggagcgggtt
gtgcgcaccgtccgccagcacctggacgacgtccgctgggtggtgctcgacctgcgccgg
gtggccgccgtccgggagcccgccctcgagctcctgcgggtgctgctcgacgagctggcc
agccgggacgtcaacgtcctgttcgccgacccgcgtgggcttccgggcgtcgaccgcctg
atgcggggggactggagcacgcagcgcgttcccgatctggagaccgcactcgaatgggcg
gaggaggcgctgctgatgcgcgaggacctcgcgaccctcccgccgaccgcgcacgtcccg
ctcggcgcgcaggaactgctcaccgatctcggcaaggagggcacccgggtcatcggcgcg
atgtgcgaacgacgcacctacgaacgcggcgcgacggtcttcgacgagggagatccggcg
gacgcgctctacttcgtcaccaggggcctggcgaacgcgcaggcgccgaacgcggacggg
acgcgctggttccggctcagctcggttccagccggcagtgcgttcggtgagctggcactc
gtcgatggcggccggcgttccacccggatcgtcgtcgcggagaccatgacctgcgaggtg
ctctcggtcgcggcgttcgacaccctggtgcgggagcatccggacgtctacaacgcgctg
gtgcgcgcgatcgcgcgcagcctctcggcacagctgcgccgagcgacccgggagatccag
tcgctcgaagagtga

DBGET integrated database retrieval system