KEGG   Frankia sp. EAN1pec: Franean1_0297Help
Entry
Franean1_0297     CDS       T00608                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fre  Frankia sp. EAN1pec
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fre00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(349657..350430)
Genome map
AA seq 257 aa AA seqDB search
MTSDSDQAQTIVRQAGELNAGSSGLDQGVSPESATESNVSDNVTDAKDAGSGAGNGVEAR
RLKRPEMVRPFDHERVARAVRELLIGIGEDPDREGLRKTPDRVARAYQEAVEGLGRDPAE
VLTTVFDEGHDEMVLVRDIDFSSLCEHHLVVFAGKAHVAYIPNEKGQITGLSKLARLVDL
YARRPQVQERLTSQVADALVDVLDPRGVMVVVEAEHLCMSMRGVRKPGATTVTSAVRGQF
LSPATRSEGMSLIIRGR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
ttgacctccgattccgaccaggcgcagaccatcgtgcgacaggccggtgagctgaacgcg
ggctcctccggactggaccagggcgtctcgccggaatcggccaccgagagcaacgtctcg
gacaacgtgaccgacgcgaaggacgccggcagcggtgctggcaacggcgtcgaggcgcgg
cggctgaagcggccggagatggttcggcccttcgaccacgagcgggtcgcacgggccgtc
cgtgagttgctgatcggcatcggcgaggacccggaccgcgagggcctacgcaagaccccg
gaccgcgtcgcgcgcgcctaccaggaagcggtcgagggcctcggccgggacccggcggaa
gtcctgaccacggtcttcgacgagggccacgacgagatggtgctggtccgcgacatcgac
ttctcgtcgctgtgcgagcaccacctcgtggtcttcgccggcaaggcgcacgtggcctac
atcccgaacgagaaggggcagatcaccggcctgtccaagctggcccggctggtcgacctc
tatgcccgccggccgcaggtccaggagcgcctcacctctcaggtcgccgacgcactcgtc
gacgtcctcgacccgcggggcgtcatggtcgtcgtcgaggcggagcacctctgcatgtcg
atgcgcggtgtccgcaagccgggggcgaccacggtgacctcggcggtgcgcggccagttc
ctgagcccggccacccgcagcgagggaatgtcgctgatcattcggggtcgctga

DBGET integrated database retrieval system