KEGG   Frankia sp. EAN1pec: Franean1_0688Help
Entry
Franean1_0688     CDS       T00608                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fre  Frankia sp. EAN1pec
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Franean1_0688
   00052 Galactose metabolism
    Franean1_0688
   00500 Starch and sucrose metabolism
    Franean1_0688
   00520 Amino sugar and nucleotide sugar metabolism
    Franean1_0688
Enzymes [BR:fre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Franean1_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
807092..808096
Genome map
AA seq 334 aa AA seqDB search
MPVTKAVIPAAGLGTRFLPATKSVPKEMLPVVDRPAIEYVVEEASRAGLRDVLLVTSRTK
KAIEDHFDREGDVEAALERKGDKVRLERVRASAELAEVHSVRQPSPRGLGHAVLCASAHV
GDEPFAVLLGDDLIDERDPLLVEMLAVQERHGGAVVALMEVPEEAVSMYGVATIAPTAAA
PASAAPASAVSAVSAASVERVSAGGSGGRYRTVRITDLVEKPPVDEAPSNLAVIGRYVLP
AEIFDVLRATPPGRGDEIQLTDALRTLAERAGADPGAEIPVHGVVFTGRRYDTGDRVDYL
KAVVRLACERPDLGPEFYPWLEEYVASGGPKAEC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgacgaaggcggtcattcccgccgcgggtctggggacccggttcctgcccgcg
acgaagtcggttccgaaggagatgctacctgtcgtcgacaggccggccatcgaatacgtc
gtcgaagaggcctcccgcgcgggcctgcgtgatgtgctgctcgtgacgagccgcaccaag
aaggccatcgaggaccacttcgaccgggagggggatgtcgaggccgcgcttgagcgcaag
ggcgacaaggttcgcctcgaacgcgtccgggcctccgccgagctggccgaggtccactcc
gtccgtcagccctcgccgcgggggctcggtcacgccgttctgtgcgcctccgcgcacgtg
ggcgacgagccgttcgcggtcctgctcggggacgatctcatcgacgagcgtgacccgctg
ctggtcgagatgctcgccgtccaggagcggcacggcggggcggtcgtcgcgctgatggag
gtgcccgaggaggccgtctccatgtacggcgtggcgacgatcgctccgacggccgctgct
cccgcctcggctgctcccgcctcggcggtctcggcggtctcggcggcttcggtggagcgg
gtctcggcgggcgggtccggcgggcgctaccggacggtgcgcatcaccgacctggtcgag
aagccgccggtggacgaggcgcccagcaacctggctgtcatcgggcgctacgtgctgcct
gcggagatcttcgacgtcctgcgggccacgccgcccggccggggggacgagatccagctg
accgacgcgctgcggacgctggcggagcgggccggcgccgatccgggcgcggagattccg
gtgcacggcgtcgtgttcaccgggcgccgttatgacaccggtgaccgggtcgactacctc
aaggcggtcgtccggctcgcctgcgagcggccggacctcggcccggagttctacccgtgg
ctggaggagtacgtggcgtccggcggtcccaaggccgaatgctga

DBGET integrated database retrieval system