KEGG   Frankia sp. EAN1pec: Franean1_0747Help
Entry
Franean1_0747     CDS       T00608                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fre00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:fre00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(872297..873199)
Genome map
AA seq 300 aa AA seqDB search
MPVRRSIYALSLAEVQAFTDALNTLKQSGVYDQFVTRHHTAMMTFTPTSQAVRNAAHKGP
SFLPWHRQSLLEFESALGAVLPDFGIPYWPWEADAALPDPKQALIWTADYFGGNGLQSNG
WYVQDGPFVSWQAIILNSSTGQLVPRSRAGLIRKFAVDTGATTLPTQADVTDCLTESQYD
RSPWIDSQSTSPSFRNRIEGFLRHAGESSTQARMHGRVHRWVGGDMGVSTSPNDPIFWLH
HSNVDRIWSVWQASGHATDYLPVTGGPTGHNLNDALLGLATSGVTPASLLDITALGYSYE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgttcgtcgaagtatctacgcactcagtctggccgaggtccaggcgttcaccgac
gcactgaacaccctgaagcagtcaggtgtctacgaccagttcgtgacacggcatcacacc
gcaatgatgactttcacaccgacgtcacaggccgtacggaacgccgcacacaagggaccg
tcgttcctgccctggcaccgccagtcactcctcgagttcgaatccgcgctcggtgcggtc
ctgcccgatttcggaatcccttactggccgtgggaggccgacgccgcgttacctgacccg
aaacaggcgctgatctggacggcggactacttcggtgggaacggtctgcagagcaacggc
tggtatgtacaggacggaccgttcgtcagctggcaggcgatcatcctgaacagctcgacg
ggtcagctcgtcccccgttcaagggctggactcatccggaagttcgcggtggacaccggc
gcgacaaccctgccgacacaggcggacgtcaccgactgcctcaccgagtcgcagtacgac
cgctccccctggatcgactcccagagcacgagtccgagtttccgtaaccggatagagggc
ttcctccggcacgccggcgagtcgtccacccaggcgaggatgcacggccgggtgcatcgg
tgggtcggcggcgacatgggcgtcagcacgtccccgaacgacccgatcttctggctgcat
cactcgaacgtcgaccggatctggtcggtgtggcaggcgtccgggcacgccaccgactac
ctcccggtcaccggcgggccgacgggccacaacctgaacgacgcgctgctgggtcttgcc
acgtcgggagtcacgcccgcctcgttgctggacatcaccgcactcggctacagctacgag
tag

DBGET integrated database retrieval system