KEGG   Frankia sp. EAN1pec: Franean1_0747Help
Entry
Franean1_0747     CDS       T00608                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
fre  Frankia sp. EAN1pec
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fre00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Franean1_0747
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Franean1_0747
Enzymes [BR:fre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Franean1_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
Position
complement(872297..873199)
Genome map
AA seq 300 aa AA seqDB search
MPVRRSIYALSLAEVQAFTDALNTLKQSGVYDQFVTRHHTAMMTFTPTSQAVRNAAHKGP
SFLPWHRQSLLEFESALGAVLPDFGIPYWPWEADAALPDPKQALIWTADYFGGNGLQSNG
WYVQDGPFVSWQAIILNSSTGQLVPRSRAGLIRKFAVDTGATTLPTQADVTDCLTESQYD
RSPWIDSQSTSPSFRNRIEGFLRHAGESSTQARMHGRVHRWVGGDMGVSTSPNDPIFWLH
HSNVDRIWSVWQASGHATDYLPVTGGPTGHNLNDALLGLATSGVTPASLLDITALGYSYE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgttcgtcgaagtatctacgcactcagtctggccgaggtccaggcgttcaccgac
gcactgaacaccctgaagcagtcaggtgtctacgaccagttcgtgacacggcatcacacc
gcaatgatgactttcacaccgacgtcacaggccgtacggaacgccgcacacaagggaccg
tcgttcctgccctggcaccgccagtcactcctcgagttcgaatccgcgctcggtgcggtc
ctgcccgatttcggaatcccttactggccgtgggaggccgacgccgcgttacctgacccg
aaacaggcgctgatctggacggcggactacttcggtgggaacggtctgcagagcaacggc
tggtatgtacaggacggaccgttcgtcagctggcaggcgatcatcctgaacagctcgacg
ggtcagctcgtcccccgttcaagggctggactcatccggaagttcgcggtggacaccggc
gcgacaaccctgccgacacaggcggacgtcaccgactgcctcaccgagtcgcagtacgac
cgctccccctggatcgactcccagagcacgagtccgagtttccgtaaccggatagagggc
ttcctccggcacgccggcgagtcgtccacccaggcgaggatgcacggccgggtgcatcgg
tgggtcggcggcgacatgggcgtcagcacgtccccgaacgacccgatcttctggctgcat
cactcgaacgtcgaccggatctggtcggtgtggcaggcgtccgggcacgccaccgactac
ctcccggtcaccggcgggccgacgggccacaacctgaacgacgcgctgctgggtcttgcc
acgtcgggagtcacgcccgcctcgttgctggacatcaccgcactcggctacagctacgag
tag

DBGET integrated database retrieval system